1. Recombinant Proteins
  2. Cytokines and Growth Factors CAR-T Related Proteins CD Antigens
  3. TNF Superfamily T Cell CD Proteins Macrophage CD Proteins Erythrocyte CD Proteins
  4. TNF Receptor Superfamily CD30
  5. CD30/TNFRSF8 Protein, Human (HEK293, His)

CD30/TNFRSF8 Protein, Human (HEK293, His)

Cat. No.: HY-P70023
SDS COA Handling Instructions

CD30/TNFRSF8 protein (TNFSF8/CD30L receptor) is a key factor regulating cell growth and lymphoblast transformation and may activate NF-kappa-B signaling. CD30/TNFRSF8 Protein, Human (HEK293, His) is the recombinant human-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD30/TNFRSF8 Protein, Human (HEK293, His) is 361 a.a., with molecular weight of 60-95 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $115 In-stock
50 μg $300 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD30/TNFRSF8 protein (TNFSF8/CD30L receptor) is a key factor regulating cell growth and lymphoblast transformation and may activate NF-kappa-B signaling. CD30/TNFRSF8 Protein, Human (HEK293, His) is the recombinant human-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD30/TNFRSF8 Protein, Human (HEK293, His) is 361 a.a., with molecular weight of 60-95 kDa.

Background

CD30/TNFRSF8 protein, as a receptor for TNFSF8/CD30L, plays a key role in the regulation of cell growth and transformation of activated lymphoblasts. In addition, it may participate in the regulation of gene expression through the activation of NF-kappa-B signaling, thereby promoting a variety of cellular processes.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human CD31L is immobilized at 2 µg/mL(100 µL/well) can bind Recombinant Human CD30. The ED50 for this effect is 51.71 ng/mL.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P28908 (F19-K379)

Gene ID

943  [NCBI]

Molecular Construction
N-term
CD30 (F19-K379)
Accession # P28908
6*His
C-term
Synonyms
rHuTumor necrosis factor receptor superfamily member 8/CD30, His; Tumor necrosis factor receptor superfamily member 8; CD30L receptor; Ki-1 antigen; Lymphocyte activation antigen CD30; CD30; TNFRSF8
AA Sequence

FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK

Molecular Weight

60-95 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD30/TNFRSF8 Protein, Human (HEK293, His)
Cat. No.:
HY-P70023
Quantity:
MCE Japan Authorized Agent: