1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Monocyte CD Proteins Pattern Recognition Receptors
  4. C-type Lectin Receptors
  5. CD302/CLEC13A
  6. CD302/CLEC13A Protein, Mouse (HEK293, His)

CD302/CLEC13A Protein, a potential multifunctional C-type lectin receptor, may engage in endocytosis, phagocytosis, cell adhesion, and migration processes. CD302/CLEC13A Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD302/CLEC13A Protein, a potential multifunctional C-type lectin receptor, may engage in endocytosis, phagocytosis, cell adhesion, and migration processes. CD302/CLEC13A Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Background

CD302/CLEC13A protein is identified as a potential multifunctional C-type lectin receptor with putative involvement in diverse cellular processes. This protein is suggested to play roles in endocytosis and phagocytosis, highlighting its potential contribution to intracellular trafficking mechanisms. Additionally, CD302/CLEC13A is implicated in cell adhesion and migration, indicating its likely participation in cellular interactions and mobility. The multifaceted nature of CD302/CLEC13A suggests its versatility in various cellular functions, emphasizing its potential significance in immune responses and other biological processes.

Biological Activity

Immobilized CD302 at 5 μg/mL (100 μL/well) can bind Mouse DEC-205/CD205 Protein (HY-P77992). The ED50 for this effect is 9.410 μg/mL.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q9DCG2-2 (D21-H156)

Gene ID
Molecular Construction
N-term
CD302 (D21-H156)
Accession # Q9DCG2-2
His
C-term
Synonyms
CD302 antigen; C-type lectin domain family 13 member A; CD302; CLEC13A
AA Sequence

DCPSSTWVQFQGSCYAFLQVTINVENIEDVRKQCTDHGADMVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDATFKWYDHSNMTFDKWADQDGEDLVDTCGFLYTKTGEWRKGDCEISSVEGTLCKAANNH

Molecular Weight

Approximately 19-23 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD302/CLEC13A Protein, Mouse (HEK293, His)
Cat. No.:
HY-P75638
Quantity:
MCE Japan Authorized Agent: