CD302/CLEC13A Protein, Mouse (HEK293, His)

CD302/CLEC13A Protein, a potential multifunctional C-type lectin receptor, may engage in endocytosis, phagocytosis, cell adhesion, and migration processes. CD302/CLEC13A Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

CD302/CLEC13A protein is identified as a potential multifunctional C-type lectin receptor with putative involvement in diverse cellular processes. This protein is suggested to play roles in endocytosis and phagocytosis, highlighting its potential contribution to intracellular trafficking mechanisms. Additionally, CD302/CLEC13A is implicated in cell adhesion and migration, indicating its likely participation in cellular interactions and mobility. The multifaceted nature of CD302/CLEC13A suggests its versatility in various cellular functions, emphasizing its potential significance in immune responses and other biological processes.

Immobilized CD302 at 5 μg/mL (100 μL/well) can bind Mouse DEC-205/CD205 Protein (HY-P77992). The ED₅₀ for this effect is 9.410 μg/mL.

Mouse

HEK293

C-6*His

Q9DCG2-2 (D21-H156)

66205  [NCBI]

DCPSSTWVQFQGSCYAFLQVTINVENIEDVRKQCTDHGADMVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDATFKWYDHSNMTFDKWADQDGEDLVDTCGFLYTKTGEWRKGDCEISSVEGTLCKAANNH

Approximately 19-23 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.