CD302/CLEC13A Protein, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

CD302/CLEC13A Protein emerges as a potential multifunctional C-type lectin receptor, suggesting its versatile involvement in various cellular processes. The protein exhibits potential roles in endocytosis and phagocytosis, indicating its participation in cellular clearance mechanisms. Moreover, CD302/CLEC13A is implicated in cell adhesion and migration, hinting at its possible contributions to cellular interactions and tissue dynamics. The multifaceted nature of CD302/CLEC13A suggests its potential significance in orchestrating diverse cellular functions, prompting further investigation to elucidate the specific mechanisms and regulatory pathways through which it operates in different cellular contexts.

Immobilized CD302 at 5 μg/mL (100 μL/well) can bind Human DEC-205/CD205 Protein(HY-P74203). The ED₅₀ for this effect is 11.01 μg/mL.

• 
  Immobilized CD302 at 5 μg/mL (100 μL/well) can bind Human DEC-205/CD205 Protein (HY-P74203). The ED₅₀ for this effect is 11.01 μg/mL.

Rat

HEK293

C-6*His

Q5FVR3 (D21-H165)

295629  [NCBI]

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Approximately 18&22 kDa

Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.