1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Monocyte CD Proteins Pattern Recognition Receptors
  4. C-type Lectin Receptors
  5. CD302/CLEC13A
  6. CD302/CLEC13A Protein, Rat (HEK293, His)

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, His) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.

Background

CD302/CLEC13A Protein emerges as a potential multifunctional C-type lectin receptor, suggesting its versatile involvement in various cellular processes. The protein exhibits potential roles in endocytosis and phagocytosis, indicating its participation in cellular clearance mechanisms. Moreover, CD302/CLEC13A is implicated in cell adhesion and migration, hinting at its possible contributions to cellular interactions and tissue dynamics. The multifaceted nature of CD302/CLEC13A suggests its potential significance in orchestrating diverse cellular functions, prompting further investigation to elucidate the specific mechanisms and regulatory pathways through which it operates in different cellular contexts.

Biological Activity

Immobilized CD302 at 5 μg/mL (100 μL/well) can bind Human DEC-205/CD205 Protein(HY-P74203). The ED50 for this effect is 11.01 μg/mL.

  • Immobilized CD302 at 5 μg/mL (100 μL/well) can bind Human DEC-205/CD205 Protein (HY-P74203). The ED50 for this effect is 11.01 μg/mL.
Species

Rat

Source

HEK293

Tag

C-6*His

Accession

Q5FVR3 (D21-H165)

Gene ID
Molecular Construction
N-term
CD302 (D21-H165)
Accession # Q5FVR3
His
C-term
Synonyms
CD302 antigen; C-type lectin domain family 13 member A; CD302; CLEC13A
AA Sequence

DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH

Molecular Weight

Approximately 18&22 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD302/CLEC13A Protein, Rat (HEK293, His)
Cat. No.:
HY-P76796
Quantity:
MCE Japan Authorized Agent: