CD34 Protein, Human (HEK293, His)

CD34 protein, a potential adhesion molecule, is vital in early hematopoiesis, aiding stem cell attachment to the bone marrow's extracellular matrix or stromal cells. It potentially serves as a scaffold for lineage-specific glycans, facilitating interaction with lectins on stromal cells. CD34 also presents carbohydrate ligands to selectins, enhancing its role in cell adhesion processes. CD34 Protein, Human (HEK293, His) is the recombinant human-derived CD34 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD34 Protein, Human (HEK293, His) is 259 a.a., with molecular weight of 60-90 kDa.

CD34 protein is a potential adhesion molecule that is thought to play a crucial role in early hematopoiesis by facilitating the attachment of stem cells to the extracellular matrix of the bone marrow or directly to stromal cells. It is speculated that CD34 may also act as a scaffold for the binding of lineage-specific glycans, enabling stem cells to interact with lectins expressed by stromal cells or other components of the marrow. Additionally, CD34 is known to present carbohydrate ligands to selectins, further contributing to its involvement in cell adhesion processes.

Human

HEK293

C-6*His

P28906 (S32-T290)

947  [NCBI]

SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT

60-90 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.