1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Stem Cell CD Proteins Platelet CD Proteins Erythrocyte CD Proteins Dendritic Cell CD Proteins Endothelial cell CD Proteins
  4. CD36/SR-B2 CD36/SR-B2
  5. CD36 Protein, Human (HEK293, Fc )

CD36 is a multifunctional glycoprotein that serves as a receptor for a variety of ligands, including thrombospondin and oxidized low-density lipoprotein. Ligand induces CD36 clusters, initiating signal transduction and internalization. CD36 Protein, Human (HEK293, Fc ) is the recombinant human-derived CD36 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD36 is a multifunctional glycoprotein that serves as a receptor for a variety of ligands, including thrombospondin and oxidized low-density lipoprotein. Ligand induces CD36 clusters, initiating signal transduction and internalization. CD36 Protein, Human (HEK293, Fc ) is the recombinant human-derived CD36 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CD36 is a versatile glycoprotein serving as a receptor for a diverse array of ligands, encompassing proteinaceous entities like thrombospondin, fibronectin, collagen, or amyloid-beta, as well as lipidic components such as oxidized low-density lipoprotein (oxLDL), anionic phospholipids, long-chain fatty acids, and bacterial diacylated lipopeptides. Exhibiting multivalency, these ligands can engage multiple receptors simultaneously, prompting the formation of CD36 clusters that initiate signal transduction and the internalization of receptor-ligand complexes. The dependency on coreceptor signaling is notably ligand specific. Cellular responses to these ligands play pivotal roles in angiogenesis, inflammatory responses, fatty acid metabolism, taste, and dietary fat processing in the intestine. Additionally, CD36 binds long-chain fatty acids, facilitating their transport into cells and participating in muscle lipid utilization, adipose energy storage, and gut fat absorption. Mechanistically, fatty acid binding activates downstream kinase LYN, phosphorylating palmitoyltransferase ZDHHC5 and leading to CD36 depalmitoylation and caveolar endocytosis. In the small intestine, CD36 plays a role in the proximal absorption of dietary fatty acids and cholesterol, potentially through the activation of the MAPK1/3 (ERK1/2) signaling pathway. It is also involved in oral fat perception and preferences, mediating intracellular calcium level increases in taste receptor cells. Furthermore, CD36 is a significant factor in ventromedial hypothalamus neuronal sensing of long-chain fatty acids and the regulation of energy and glucose homeostasis. Acting as a receptor for thrombospondins, CD36 mediates their antiangiogenic effects and induces apoptosis in podocytes in response to elevated free fatty acids, in collaboration with THBS1. As a coreceptor for TLR4:TLR6 heterodimer, CD36 promotes inflammation in monocytes/macrophages upon ligand binding, leading to NF-kappa-B-dependent cytokine production and IL1B secretion through the priming and activation of the NLRP3 inflammasome. Furthermore, CD36 serves as a selective and nonredundant sensor of microbial diacylated lipopeptides, triggering NF-kappa-B-dependent TNF production and subsequent Golgi targeting in a lipid-raft dependent pathway through TLR2:TLR6 heterodimer signaling. In the context of microbial infection, CD36 directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and the internalization of particles independently of TLR signaling.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human CD36 is immobilized at 2 µg/mL (100 µL/well) can bind Recombinant Human TSP-2. The ED50 for this effect is 53.53 ng/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Human CD36 is immobilized at 2 µg/mL (100 µL/well) can bind Recombinant Human TSP-2 .The ED50 for this effect is 53.53 ng/mL.
Species

Human

Source

HEK293

Tag

C-hFc

Accession

P16671-1 (G30-N439)

Gene ID

948  [NCBI]

Molecular Construction
N-term
CD36 (G30-N439)
Accession # P16671
hFc
C-term
Synonyms
rHuPlatelet glycoprotein 4/CD36, Fc; Fatty acid translocase; Glycoprotein IIIb; FATCHDS7; Leukocyte differentiation antigen CD36; PAS IV; Platelet collagen receptor; SCARB3; Thrombospondin receptor; CD36
AA Sequence

GDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKIN

Molecular Weight

Approximately 90-130 kDa due to the glycosylation.

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD36 Protein, Human (HEK293, Fc ) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD36 Protein, Human (HEK293, Fc )
Cat. No.:
HY-P70004
Quantity:
MCE Japan Authorized Agent: