CD39L1/ENTPD2 Protein, Human (HEK293, His)

CD39L1/ENTPD2 protein, expressed in the nervous system, efficiently hydrolyzes ATP and various nucleotides, while showing limited hydrolysis of ADP. Its substrate specificity hierarchy highlights its regulatory role in purinergic signaling and selective nucleotide hydrolysis, contributing to precise control of neurotransmission. CD39L1/ENTPD2 Protein, Human (HEK293, His) is the recombinant human-derived CD39L1/ENTPD2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD39L1/ENTPD2 Protein, Human (HEK293, His) is 432 a.a., with molecular weight of ~60 kDa.

CD39L1/ENTPD2 protein, predominantly expressed in the nervous system, plays a pivotal role in the regulation of purinergic neurotransmission by efficiently hydrolyzing ATP and various nucleotides. Notably, CD39L1/ENTPD2 exhibits only marginal hydrolysis of ADP, indicating a substrate specificity that distinguishes it from broader nucleotide hydrolysis. The order of enzymatic activity with different substrates reveals a preference hierarchy, with ATP being hydrolyzed most effectively, followed by GTP, CTP, ITP, and UTP, whereas ADP and UDP show considerably lower hydrolytic efficiency. This nuanced substrate specificity underscores the intricate regulatory role of CD39L1/ENTPD2 in modulating purinergic signaling pathways within the nervous system, emphasizing its contribution to the finely tuned control of neurotransmission through selective nucleotide hydrolysis.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

C-6*His

Q9Y5L3 (T29-D460)

954  [NCBI]

TRDVREPPALKYGIVLDAGSSHTSMFIYKWPADKENDTGIVGQHSSCDVPGGGISSYADNPSGASQSLVGCLEQALQDVPKERHAGTPLYLGATAGMRLLNLTNPEASTSVLMAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENFIKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSFLCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVLLGDVYQSPCTMAQRPQNFNSSARVSLSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFVAFSAFFYTVDFLRTSMGLPVATLQQLEAAAVNVCNQTWAQLQARVPGQRARLADYCAGAMFVQQLLSRGYGFDERAFGGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLRKGTD

Approximately 60 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 5 mM CaCl2, 10% Glycerol, pH 7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.