CD3E-CD3G Heterodimer Protein, Human (HEK293, Fc-Flag & mFc)

CD3 epsilon, a crucial part of the TCR-CD3 complex on T-lymphocytes, facilitates TCR-mediated signal transmission. When APCs activate TCR, CD3 epsilon, with CD3D, CD3G, and CD3Z, relays signals across the cell membrane via ITAMs. LCK and FYN phosphorylate CD3 epsilon upon TCR engagement, initiating downstream signaling. Essential for T-cell development, CD3 epsilon forms heterodimers, initiating TCR-CD3 complex assembly. It's vital for TCR-CD3 complex internalization and down-regulation, interacting with CD6, NCK1, and NUMB, underscoring its pivotal role in T-cell processes. CD3E-CD3G Heterodimer Protein, Human (HEK293, Fc-Flag & mFc) is a recombinant protein dimer complex containing human-derived CD3E-CD3G Heterodimer protein, expressed by HEK293, with C-hFc, C-Flag, C-mFc labeled tag. CD3E-CD3G Heterodimer Protein, Human (HEK293, Fc-Flag & mFc), has molecular weight of 42-47 kDa.

CD3 epsilon, an integral component of the TCR-CD3 complex on the surface of T-lymphocytes, plays a crucial role in the adaptive immune response. As antigen-presenting cells (APCs) activate the T-cell receptor (TCR), CD3 epsilon, along with other CD3 chains (CD3D, CD3G, and CD3Z), facilitates the transmission of TCR-mediated signals across the cell membrane. Containing immunoreceptor tyrosine-based activation motifs (ITAMs) in its cytoplasmic domain, CD3 epsilon undergoes phosphorylation by Src family protein tyrosine kinases LCK and FYN upon TCR engagement, leading to the activation of downstream signaling pathways. Beyond its role in signal transduction, CD3 epsilon is essential for proper T-cell development, initiating the assembly of the TCR-CD3 complex by forming the heterodimers CD3D/CD3E and CD3G/CD3E. Additionally, CD3 epsilon is involved in the internalization and cell surface down-regulation of TCR-CD3 complexes through endocytosis sequences present in its cytosolic region. The TCR-CD3 complex comprises CD3D/CD3E and CD3G/CD3E heterodimers, which preferentially associate with TCRalpha and TCRbeta, forming trimers that interact with CD3Z homodimers to complete the hexameric TCR-CD3 complex. Alternatively, TCRgamma and TCRdelta can replace TCRalpha and TCRbeta. CD3 epsilon's interactions with CD6, NCK1, and NUMB further highlight its pivotal role in orchestrating T-cell activation, development, and internalization processes.

Measured by its ability to bind OKT3-mIgG2a in a functional ELISA.

Human

HEK293

C-hFc;C-Flag;C-mFc

P07766/NP_000724 (D23-D126) & P09693/NP_000064 (Q23-S116)

916  [NCBI]&917

MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD

42-47 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.