CD40L/CD154/TRAP Protein, Rabbit (P. pastoris, His)

CD40L/CD154/TRAP Protein, a cytokine, acts as a CD40/TNFRSF5 ligand, stimulating T-cell proliferation and cytokine production. It also facilitates immunoglobulin class switching and binds to integrins ITGA5:ITGB1 and ITGAV:ITGB3. CD40-CD40LG signaling requires both integrins and the CD40 receptor, leading to cell-type dependent effects like B-cell activation, NF-kappa-B signaling, and anti-apoptotic signaling. CD40L/CD154/TRAP Protein, Rabbit (P. pastoris, His) is the recombinant Rabbit-derived CD40L/CD154/TRAP protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of CD40L/CD154/TRAP Protein, Rabbit (P. pastoris, His) is 149 a.a., with molecular weight of 18.2 kDa.

CD40L/CD154/TRAP Protein is a cytokine that functions as a ligand to CD40/TNFRSF5. It plays a crucial role in costimulating T-cell proliferation and cytokine production. Additionally, it is involved in immunoglobulin class switching. CD40L/CD154/TRAP Protein acts as a ligand for integrins, specifically ITGA5:ITGB1 and ITGAV:ITGB3. Activation of CD40-CD40LG signaling requires both integrins and the CD40 receptor, and this signaling pathway has cell-type dependent effects, including B-cell activation, NF-kappa-B signaling, and anti-apoptotic signaling.

Rabbit

P. pastoris

N-6*His

G1SKP7 (M113-L261)

100358388  [NCBI]

MQKGDQDPQIAAHLISEASSKSSSVLQWAKKGYYTMSNTLVTLENGKQLKVKRQGFYYIYAQVTFCSNQEPSSQAPFIASLCLKSSGGSERILLRAANARSSSKTCEQQSIHLGGVFELQADASVFVNVTDASQVNHGTGFTSFGLLKL

18.2 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.