1. Recombinant Proteins
  2. CD Antigens
  3. Platelet CD Proteins
  4. CD42c/GP-Ib beta
  5. CD42c/GP1BB Protein, Human (HEK293, His)

CD42c/GP1BB protein, present on platelets, interacts with von Willebrand factor to form platelet plugs. It forms a heterodimer with GP1B beta subunits and associates with GP-IX, facilitating platelet adhesion and initiating thrombus formation. CD42c also interacts with TRAF4, potentially regulating cellular signaling pathways. CD42c/GP1BB Protein, Human (HEK293, His) is the recombinant human-derived CD42c/GP1BB protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD42c/GP1BB protein, present on platelets, interacts with von Willebrand factor to form platelet plugs. It forms a heterodimer with GP1B beta subunits and associates with GP-IX, facilitating platelet adhesion and initiating thrombus formation. CD42c also interacts with TRAF4, potentially regulating cellular signaling pathways. CD42c/GP1BB Protein, Human (HEK293, His) is the recombinant human-derived CD42c/GP1BB protein, expressed by HEK293 , with C-His labeled tag.

Background

CD42c, also known as GP1BB, is a surface membrane protein on platelets crucial for the formation of platelet plugs through its interaction with von Willebrand factor, which is pre-bound to the subendothelium. The GP1BB protein forms a heterodimer with two disulfide-linked GP1B beta subunits and associates non-covalently with GP-IX. This intricate complex of GP1BB, GP1B alpha, and GP-IX plays a pivotal role in mediating platelet adhesion and initiating the process of thrombus formation. Additionally, CD42c has been identified to interact with TRAF4, suggesting potential regulatory roles in cellular signaling pathways.

Species

Human

Source

HEK293

Tag

C-His

Accession

P13224-1/NP_000398.1 (P27-C147)

Gene ID
Molecular Construction
N-term
GP1BB (P27-C147)
Accession # P13224-1/NP_000398.1
His
C-term
Synonyms
Platelet glycoprotein Ib beta chain; GPIb-beta; CD42b-beta
AA Sequence

MGSGPRGALSLLLLLLAPPSRPAAGCPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLC

Molecular Weight

Approximately 20 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD42c/GP1BB Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD42c/GP1BB Protein, Human (HEK293, His)
Cat. No.:
HY-P76805
Quantity:
MCE Japan Authorized Agent: