CD42c/GP1BB Protein, Rat (HEK293, Fc)

The CD42c protein is a platelet surface membrane protein that actively assembles plugs by binding to von Willebrand factor (vWF) in the subendothelium. The GP-Ib heterodimer is formed from the disulfide-linked GP-Ib β subunit and one GP-Ib α subunit, which constitute this protein complex. CD42c/GP1BB Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD42c protein, expressed by HEK293 , with C-hFc labeled tag.

CD42c, a surface membrane protein on platelets, actively contributes to the assembly of platelet plugs by engaging with von Willebrand factor (vWF), which is pre-bound to the subendothelium. This protein complex comprises two GP-Ib beta subunits disulfide-linked to one GP-Ib alpha subunit, forming the GP-Ib heterodimer. Additionally, GP-IX is intricately associated with the GP-Ib heterodimer through a non-covalent linkage, enhancing the structural integrity and functionality of this platelet surface receptor. In molecular interactions, CD42c shows similarity to its association with tumor necrosis factor receptor-associated factor 4 (TRAF4), contributing to the regulatory network governing platelet function.

Rat

HEK293

C-hFc

Q9JJM7 (P27-C147)

116727  [NCBI]

PAPCRCSETRVDCGRRGLTWASLPAAFPPDTTELVLTDNNLTALPPGLLDTLPALRRVHLGANPWRCDCRLLPLRAWLAGRPEREFYRDLRCVAPLALRGRLLPYVAEDELRAACAPGLLC

Approximately 45-55 kDa due to the glycosylation.

Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.