1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Stem Cell CD Proteins Platelet CD Proteins Erythrocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. Integrin Associated Protein/CD47
  5. CD47 Protein, Cynomolgus/Rhesus Macaque (HEK293, C-His)

CD47 Protein, Cynomolgus/Rhesus Macaque (HEK293, C-His)

Cat. No.: HY-P700682
SDS COA Handling Instructions Technical Support

CD47 is a leukocyte surface antigen, and high expression of CD47 helps tumors escape. CD47 inhibition leads to the activation of CD103+ dendritic cells, which leads to the recruitment and activation of natural killer cells and inhibits cancer development. CD47 Protein, Cynomolgus/Rhesus Macaque (HEK293, C-His) is the recombinant Rhesus Macaque, cynomolgus-derived CD47 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD47 is a leukocyte surface antigen, and high expression of CD47 helps tumors escape. CD47 inhibition leads to the activation of CD103+ dendritic cells, which leads to the recruitment and activation of natural killer cells and inhibits cancer development. CD47 Protein, Cynomolgus/Rhesus Macaque (HEK293, C-His) is the recombinant Rhesus Macaque, cynomolgus-derived CD47 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD47 is a receptor for the C-terminal cell-binding domain of leukocyte surface antigen and thrombospondin. CD47 controls the increase in intracellular calcium concentration when cells adhere to the extracellular matrix and may play a role in membrane trafficking and signal transduction. The CD47 gene has broad tissue distribution and low expression on Rh erythrocytes. High expression levels of CD47 help cancer cells evade the immune system. For example, studies have found that high expression of CD47 is associated with poor prognosis in HCC patients. CD47 inhibition can enhance the ability of CD103+ DCs to take up tumor DNA, thereby stimulating the cGAS-STING pathway and promoting the infiltration and activation of liver natural killer cells in cancer cells. CD47 also binds to proteins including thrombospondin-1 (TSP-1), signal regulatory protein alpha (SIRPα), integrins, and protein tyrosine phosphatase substrate with SH2 domain-1 (SHPS-1). Ligand. and regulates phagocytosis of macrophages, migration of neutrophils, and activation of dendritic cells, T cells, and B cells. Some CD47 antibodies may inhibit the CD47-SIRPα axis to enhance phagocytosis of cancer cells.

Biological Activity

1.Immobilized Cynomolgus/Rhesus macaque CD47, His Tag at 5 μg/mL (100 μl/well) on the plate. Dose response curve for Human SIRP alpha, hFc Tag with the EC50 of ≤1 μg/mL determined by ELISA.
2.Measured by its binding ability in a functional ELISA. Immobilized Human SIRP alpha at 2 μg/mL (100 μL/well) can bind Cynomolgus CD47. The ED50 for this effect is ≤1 μg/mL.

Species

Rhesus Macaque; Cynomolgus

Source

HEK293

Tag

C-His

Accession

F7A802/NP_001253446 (Q19-E142)

Gene ID

704980  [NCBI]/102139846

Molecular Construction
N-term
CD47 (Q19-E142)
Accession # F7A802/NP_001253446
His
C-term
Synonyms
CD47 glycoprotein; CD47 molecule; CD47; IAP; OA3; MER6
AA Sequence

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTAPANFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNEN

Molecular Weight

Approximately 30-43 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD47 Protein, Cynomolgus/Rhesus Macaque (HEK293, C-His)
Cat. No.:
HY-P700682
Quantity:
MCE Japan Authorized Agent: