CD5 Protein, Human (HEK293, His)

The CD5 protein is a potential receptor that regulates T cell proliferation. Its interactions with CD72/LYB-2 and PTPN6/SHP-1 indicate multifaceted roles in cellular processes, serving as key mediators of T cell responses. CD5 Protein, Human (HEK293, His) is the recombinant human-derived CD5 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD5 Protein, Human (HEK293, His) is 348 a.a., with molecular weight of ~48.9 kDa.

The CD5 Protein presents itself as a potential receptor implicated in the regulation of T-cell proliferation. Its interaction with CD72/LYB-2 and PTPN6/SHP-1 suggests a multifaceted role in modulating cellular processes. Acting as a receptor, this protein may play a pivotal part in orchestrating T-cell responses, mediating crucial interactions with other cellular components. The engagement with CD72/LYB-2 and PTPN6/SHP-1 underscores its involvement in intricate signaling pathways, hinting at its significance in the regulatory networks that govern T-cell behavior. Further exploration of the CD5 Protein's functions could provide valuable insights into the molecular mechanisms underlying T-cell proliferation and immune modulation.

Immobilized Human CD5 at 2 μg/mL (100 μL/well) can bind Anti-CD5 Antibody. The ED₅₀ for this effect is 19.66 ng/mL.

Human

HEK293

C-His

P06127 (R25-P372)

921  [NCBI]

RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNP

Approximately 48.9 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.