1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins B Cell CD Proteins Dendritic Cell CD Proteins Cell Adhesion-related CD Proteins
  4. CD5
  5. CD5 Protein, Mouse (HEK293, His)

CD5 protein, acting as a receptor, crucially regulates T-cell proliferation by engaging in vital interactions with CD72/LYB-2. Additionally, its potential interactions with PTPN6/SHP-1 highlight its integral role in essential signaling pathways. CD5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD5 protein, acting as a receptor, crucially regulates T-cell proliferation by engaging in vital interactions with CD72/LYB-2. Additionally, its potential interactions with PTPN6/SHP-1 highlight its integral role in essential signaling pathways. CD5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CD5 protein functions as a receptor that plays a pivotal role in the regulation of T-cell proliferation. It is involved in crucial interactions with CD72/LYB-2 and also exhibits potential interactions with PTPN6/SHP-1, indicating its involvement in important signaling pathways.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P13379 (Q24-N370)

Gene ID
Molecular Construction
N-term
CD5 (Q24-N370)
Accession # P13379
6*His
C-term
Synonyms
T-cell surface glycoprotein CD5; Ly-1; Lyt-1; CD5; Leu-1
AA Sequence

QSGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWEALCDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFLCAQEKLSQCYHLQKKKHCNKRVFVTCQDPN

Molecular Weight

42-58 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD5 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P72722
Quantity:
MCE Japan Authorized Agent: