1. Recombinant Proteins
  2. CD Antigens Biotinylated Proteins
  3. T Cell CD Proteins B Cell CD Proteins Dendritic Cell CD Proteins Cell Adhesion-related CD Proteins
  4. CD5
  5. CD5 Protein, Rhesus Macaque (HEK293, His-Avi)

CD5 Protein, Rhesus Macaque (HEK293, His-Avi)

Cat. No.: HY-P77618
COA Handling Instructions

CD5 Protein lacks conserved residue(s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His-Avi) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of CD5 Protein, Rhesus Macaque (HEK293, His-Avi) is 351 a.a., with molecular weight of 55-60 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg $130 In-stock
50 μg $250 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD5 Protein lacks conserved residue(s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His-Avi) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of CD5 Protein, Rhesus Macaque (HEK293, His-Avi) is 351 a.a., with molecular weight of 55-60 kDa.

Background

The CD5 protein is distinguished by its deficiency in conserved residue(s) crucial for the propagation of feature annotation.

Biological Activity

Immobilized Rhesus macaque CD5 at 1 μg/mL (100 μL/Well) on the plate. Dose response curve for Anti-CD5 Antibody with the EC50 of ≤ 8.71 ng/mL determined by ELISA.

Species

Rhesus Macaque

Source

HEK293

Tag

C-Avi;C-His

Accession

F6V5Q9 (R25-P375)

Gene ID

/

Molecular Construction
N-term
CD5 (R25-P375)
Accession # F6V5Q9
His-Avi
C-term
Synonyms
CD5 molecule; CD5; LEU1; T1; CD5 antigen
AA Sequence

RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP

Molecular Weight

55-60 kDa

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD5 Protein, Rhesus Macaque (HEK293, His-Avi)
Cat. No.:
HY-P77618
Quantity:
MCE Japan Authorized Agent: