1. Recombinant Proteins
  2. CD Antigens Complement System
  3. Platelet CD Proteins Erythrocyte CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins Complement Regulatory Proteins
  4. DAF Protein/CD55 Decay Accelerating Factor (DAF)
  5. CD55/DAF Protein, Mouse (361a.a, HEK293, His)

CD55/DAF Protein, Mouse (361a.a, HEK293, His)

Cat. No.: HY-P75655
COA Handling Instructions

The CD55/DAF protein is critical in the immune system and recognizes C4b and C3b fragments. It interacts with cell-associated C4b and C3b, interfering with their enzymatic conversion and preventing the formation of complement cascade amplifying convertase. CD55/DAF Protein, Mouse (361a.a, HEK293, His) is the recombinant mouse-derived CD55/DAF protein, expressed by HEK293 , with C-His labeled tag. The total length of CD55/DAF Protein, Mouse (361a.a, HEK293, His) is 361 a.a., with molecular weight of ~60 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg $95 In-stock
10 μg $160 In-stock
20 μg $250 In-stock
50 μg $490 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD55/DAF protein is critical in the immune system and recognizes C4b and C3b fragments. It interacts with cell-associated C4b and C3b, interfering with their enzymatic conversion and preventing the formation of complement cascade amplifying convertase. CD55/DAF Protein, Mouse (361a.a, HEK293, His) is the recombinant mouse-derived CD55/DAF protein, expressed by HEK293 , with C-His labeled tag. The total length of CD55/DAF Protein, Mouse (361a.a, HEK293, His) is 361 a.a., with molecular weight of ~60 kDa.

Background

CD55/DAF Protein plays a crucial role in the immune system by recognizing C4b and C3b fragments generated during C4 and C3 activation. Its interaction with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb, preventing the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade. This interference serves as a regulatory mechanism, inhibiting complement activation and preventing the formation of C3 and C5 convertases, thereby mitigating complement-induced damage. CD55/DAF's ability to recognize and modulate complement components underscores its crucial role in immune regulation and the protection of host cells from complement-mediated harm.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q61475 (M1-T361)

Gene ID
Molecular Construction
N-term
DAF (M1-T361)
Accession # Q61475
His
C-term
Synonyms
Complement Decay-Accelerating factor; CD55; CR; DAF
AA Sequence

MIRGRAPRTRPSPPPPLLPLLSLSLLLLSPTVRGDCGPPPDIPNARPILGRHSKFAEQSKVAYSCNNGFKQVPDKSNIVVCLENGQWSSHETFCEKSCVAPERLSFASLKKEYLNMNFFPVGTIVEYECRPGFRKQPPLPGKATCLEDLVWSPVAQFCKKKSCPNPKDLDNGHINIPTGILFGSEINFSCNPGYRLVGVSSTFCSVTGNTVDWDDEFPVCTEIHCPEPPKINNGIMRGESDSYTYSQVVTYSCDKGFILVGNASIYCTVSKSDVGQWSSPPPRCIEKSKVPTKKPTINVPSTGTPSTPQKPTTESVPNPGDQPTPQKPSTVKVSATQHVPVTKTTVRHPIRTSTDKGEPNT

Molecular Weight

Approximately 60 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD55/DAF Protein, Mouse (361a.a, HEK293, His)
Cat. No.:
HY-P75655
Quantity:
MCE Japan Authorized Agent: