CD59 Protein, Rat (HEK293, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage.Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage.CD59 Protein, Rat (HEK293, His) is the recombinant rat-derived CD59 protein, expressed by HEK293 , with C-His labeled tag.

CD59 Protein emerges as a potent inhibitor of the complement membrane attack complex (MAC) action, exerting its regulatory influence at or after the C5b-8 stage of MAC assembly. This key role positions CD59 as a crucial modulator in the complement system, preventing excessive activation and the subsequent membrane damage associated with uncontrolled MAC formation. By targeting specific stages of the MAC assembly process, CD59 plays a pivotal role in maintaining the delicate balance of complement activation, highlighting its significance in the immune response and safeguarding cellular integrity from complement-mediated damage.

Measured by its binding ability in a functional ELISA. When Recombinant Human C9 is present at 5 μg/mL, can bind Recombinant Rat CD59. The ED₅₀ for this effect is 2.01 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Human C9 is present at 5 μg/mL, can bind Recombinant Rat CD59. The ED₅₀ for this effect is 2.01 μg/mL.

Rat

HEK293

C-6*His

P27274 (L23-N100)

25407  [NCBI]

LRCYNCLDPVSSCKTNSTCSPNLDACLVAVSGKQVYQQCWRFSDCNAKFILSRLEIANVQYRCCQADLCNKSFEDKPN

Approximately 14-16 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.