CD59a Protein, Mouse (HEK293, Fc)

CD59a Protein acts as a potent inhibitor of the complement membrane attack complex (MAC) by binding to C8 and/or C9 complements during MAC assembly. This interaction prevents the incorporation of multiple C9 copies, crucial for osmolytic pore formation. CD59a's regulatory role at the MAC assembly level safeguards cells, preventing uncontrolled osmolytic pore formation and protecting against complement-mediated damage. CD59a Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD59a protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD59a Protein, Mouse (HEK293, Fc) is 72 a.a., with molecular weight of ~42 kDa.

CD59a Protein emerges as a potent inhibitor of the complement membrane attack complex (MAC) action, functioning by binding to the C8 and/or C9 complements during the assembling MAC. Through this interaction, CD59a prevents the incorporation of multiple copies of C9 essential for the complete formation of the osmolytic pore. This regulatory role underscores the crucial contribution of CD59a in modulating the complement system, specifically at the level of MAC assembly, and serves as a pivotal safeguard mechanism against the uncontrolled formation of the osmolytic pore, ultimately protecting cells from potential complement-mediated damage.

Mouse

HEK293

C-hFc

O55186/NP_001104530.1 (L24-K95)

12509  [NCBI]

LTCYHCFQPVVSSCNMNSTCSPDQDSCLYAVAGMQVYQRCWKQSDCHGEIIMDQLEETKLKFRCCQFNLCNK

Approximately 42 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.