1. Recombinant Proteins
  2. CD Antigens Complement System
  3. NK Cell CD Proteins Stem Cell CD Proteins Erythrocyte CD Proteins Complement Regulatory Proteins
  4. CD59
  5. CD59a Protein, Mouse (HEK293, Fc)

CD59a Protein acts as a potent inhibitor of the complement membrane attack complex (MAC) by binding to C8 and/or C9 complements during MAC assembly. This interaction prevents the incorporation of multiple C9 copies, crucial for osmolytic pore formation. CD59a's regulatory role at the MAC assembly level safeguards cells, preventing uncontrolled osmolytic pore formation and protecting against complement-mediated damage. CD59a Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD59a protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD59a Protein, Mouse (HEK293, Fc) is 72 a.a., with molecular weight of ~42 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD59a Protein acts as a potent inhibitor of the complement membrane attack complex (MAC) by binding to C8 and/or C9 complements during MAC assembly. This interaction prevents the incorporation of multiple C9 copies, crucial for osmolytic pore formation. CD59a's regulatory role at the MAC assembly level safeguards cells, preventing uncontrolled osmolytic pore formation and protecting against complement-mediated damage. CD59a Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD59a protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD59a Protein, Mouse (HEK293, Fc) is 72 a.a., with molecular weight of ~42 kDa.

Background

CD59a Protein emerges as a potent inhibitor of the complement membrane attack complex (MAC) action, functioning by binding to the C8 and/or C9 complements during the assembling MAC. Through this interaction, CD59a prevents the incorporation of multiple copies of C9 essential for the complete formation of the osmolytic pore. This regulatory role underscores the crucial contribution of CD59a in modulating the complement system, specifically at the level of MAC assembly, and serves as a pivotal safeguard mechanism against the uncontrolled formation of the osmolytic pore, ultimately protecting cells from potential complement-mediated damage.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

O55186/NP_001104530.1 (L24-K95)

Gene ID
Molecular Construction
N-term
CD59a (L24-K95)
Accession # O55186/NP_001104530.1
hFc
C-term
Synonyms
CD59A glycoprotein; MAC-IP; MACIF; Protectin; CD59
AA Sequence

LTCYHCFQPVVSSCNMNSTCSPDQDSCLYAVAGMQVYQRCWKQSDCHGEIIMDQLEETKLKFRCCQFNLCNK

Molecular Weight

Approximately 42 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD59a Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P76809
Quantity:
MCE Japan Authorized Agent: