CD69 Protein, Human (HEK293, His)

CD69 protein, a key player in lymphocyte proliferation, acts as a signaling receptor in lymphocytes, natural killer (NK) cells, and platelets. It forms homodimers connected by disulfide bonds, highlighting its central role in cellular signaling for immune responses and platelet function. CD69 Protein, Human (HEK293, His) is the recombinant human-derived CD69 protein, expressed by HEK293 , with N-8*His labeled tag. The total length of CD69 Protein, Human (HEK293, His) is 136 a.a., with molecular weight of 18-28 kDa.

The CD69 protein plays a pivotal role in lymphocyte proliferation, serving as a signal-transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets. Structurally, it forms homodimers linked by disulfide bonds, emphasizing its involvement in cellular signaling processes crucial for immune responses and platelet function.

Human

HEK293

N-8*His

Q07108 (G64-K199)

969  [NCBI]

GQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK

18-28 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.