CD7 Protein, Human (HEK293, His)

CD7 Protein, with an elusive function, interacts with SECTM1, implying involvement in SECTM1-related cellular processes. Further research is essential to uncover the specific functions and molecular pathways in which CD7 intricately participates. The current lack of detailed information emphasizes the ongoing exploration needed to elucidate CD7's functional significance and its interplay with SECTM1 in cellular contexts. CD7 Protein, Human (HEK293, His) is the recombinant human-derived CD7 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD7 Protein, Human (HEK293, His) is 155 a.a., with molecular weight of ~32.0 kDa.

CD7 Protein, although its precise function remains elusive, is identified to interact with SECTM1. The nature of this interaction suggests a potential role for CD7 in cellular processes that involve SECTM1, emphasizing the need for further research to unravel the specific functions and molecular pathways in which CD7 is intricately involved. The current lack of detailed information underscores the ongoing exploration required to elucidate the functional significance of CD7 and its interplay with SECTM1 in cellular contexts.

Human

HEK293

C-6*His

P09564 (A26-P180)

924  [NCBI]

AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP

Approximately 32.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.