1. Recombinant Proteins
  2. CD Antigens Enzymes & Regulators
  3. B Cell CD Proteins Hydrolases (EC 3)
  4. CD72
  5. CD72 Protein, Human (Trx, His)

CD72 Protein plays a key role in orchestrating B-cell proliferation and differentiation, forming homodimers with disulfide linkages and interacting with CD5. It engages in tyrosine phosphorylation interactions with PTPN6/SHP-1, indicating its modulation of cellular responses through phosphorylation-based regulatory mechanisms. This underscores the multifaceted role of CD72 in the dynamic landscape of B-cell function and signaling. CD72 Protein, Human (N-Trx-6His) is the recombinant human-derived CD72 protein, expressed by E. coli , with N-Trx, N-His labeled tag. The total length of CD72 Protein, Human (N-Trx-6His) is 110 a.a., with molecular weight of 26-35 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD72 Protein plays a key role in orchestrating B-cell proliferation and differentiation, forming homodimers with disulfide linkages and interacting with CD5. It engages in tyrosine phosphorylation interactions with PTPN6/SHP-1, indicating its modulation of cellular responses through phosphorylation-based regulatory mechanisms. This underscores the multifaceted role of CD72 in the dynamic landscape of B-cell function and signaling. CD72 Protein, Human (N-Trx-6His) is the recombinant human-derived CD72 protein, expressed by E. coli , with N-Trx, N-His labeled tag. The total length of CD72 Protein, Human (N-Trx-6His) is 110 a.a., with molecular weight of 26-35 kDa.

Background

CD72 emerges as a key participant in the orchestration of B-cell proliferation and differentiation. Operating as a homodimer with disulfide linkages, it forms associations with CD5, thereby contributing to intricate signaling networks within the B-cell context. Additionally, CD72 engages in interactions, particularly tyrosine phosphorylation, with the protein tyrosine phosphatase PTPN6/SHP-1, indicating its involvement in modulating cellular responses through intricate phosphorylation-based regulatory mechanisms. This highlights the multifaceted role of CD72 in the dynamic landscape of B-cell function and signaling.

Species

Human

Source

E. coli

Tag

N-Trx;N-His

Accession

P21854 (R117-C226)

Gene ID

971  [NCBI]

Molecular Construction
N-term
His-Trx
CD72 (R117-C226)
Accession # P21854
C-term
Synonyms
B-cell differentiation antigen CD72; Lyb-2; CD72
AA Sequence

RYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTC

Molecular Weight

26-35 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CD72 Protein, Human (Trx, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD72 Protein, Human (Trx, His)
Cat. No.:
HY-P72711
Quantity:
MCE Japan Authorized Agent: