CD74 Protein, Human (HEK293, His)

CD74 is a key component of the class II major histocompatibility complex and serves as a key chaperone in antigen presentation in the regulation of immune responses. It doubles as a cell surface receptor for macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation. CD74 Protein, Human (HEK293, His) is the recombinant human-derived CD74 protein, expressed by HEK293 , with N-His labeled tag. The total length of CD74 Protein, Human (HEK293, His) is 160 a.a., with molecular weight of 30-40 kDa.

The CD74 Protein plays a crucial role as an associate of class II major histocompatibility complex (MHC), functioning as a vital chaperone in the regulation of antigen presentation for immune response. Additionally, it serves as a cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation upon binding. Notably, CD74 interacts with amyloid precursor protein (APP) and acts to suppress the production of amyloid beta (Abeta), implicating its potential role in neuroprotective mechanisms. The gene exhibits broad expression, with significant levels detected in spleen (RPKM 1835.3), lymph node (RPKM 1421.7), and 24 other tissues, highlighting its involvement in diverse immune and cellular processes across various organs.

Immobilized Human CD74 at 0.5 μg/mL(100 μl/Well) on the plate. Dose response curve for Anti-CD74 Antibody, hFc Tag with the EC₅₀ of 8.9 ng/mL determined by ELISA.

Human

HEK293

N-His

NP_004346.1 (Q73-M232)

792

QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

30-40 kDa

Greater than 95% as determined by Tris-Bis PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.