1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. B Cell CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins Signal Transduction-related CD Proteins
  4. CD74
  5. CD74 Protein, Human (HEK293, His)

CD74 is a key component of the class II major histocompatibility complex and serves as a key chaperone in antigen presentation in the regulation of immune responses. It doubles as a cell surface receptor for macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation. CD74 Protein, Human (HEK293, His) is the recombinant human-derived CD74 protein, expressed by HEK293 , with N-His labeled tag. The total length of CD74 Protein, Human (HEK293, His) is 160 a.a., with molecular weight of 30-40 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD74 is a key component of the class II major histocompatibility complex and serves as a key chaperone in antigen presentation in the regulation of immune responses. It doubles as a cell surface receptor for macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation. CD74 Protein, Human (HEK293, His) is the recombinant human-derived CD74 protein, expressed by HEK293 , with N-His labeled tag. The total length of CD74 Protein, Human (HEK293, His) is 160 a.a., with molecular weight of 30-40 kDa.

Background

The CD74 Protein plays a crucial role as an associate of class II major histocompatibility complex (MHC), functioning as a vital chaperone in the regulation of antigen presentation for immune response. Additionally, it serves as a cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF), initiating survival pathways and cell proliferation upon binding. Notably, CD74 interacts with amyloid precursor protein (APP) and acts to suppress the production of amyloid beta (Abeta), implicating its potential role in neuroprotective mechanisms. The gene exhibits broad expression, with significant levels detected in spleen (RPKM 1835.3), lymph node (RPKM 1421.7), and 24 other tissues, highlighting its involvement in diverse immune and cellular processes across various organs.

Biological Activity

Immobilized Human CD74 at 0.5 μg/mL(100 μl/Well) on the plate. Dose response curve for Anti-CD74 Antibody, hFc Tag with the EC50 of 8.9 ng/mL determined by ELISA.

Species

Human

Source

HEK293

Tag

N-His

Accession

NP_004346.1 (Q73-M232)

Gene ID

792

Molecular Construction
N-term
His
CD74 (Q73-M232)
Accession # NP_004346.1
C-term
Synonyms
HLA class II histocompatibility antigen gamma chain; CD74; CLIP; DHLAG
AA Sequence

QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

Molecular Weight

30-40 kDa

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD74 Protein, Human (HEK293, His)
Cat. No.:
HY-P72931
Quantity:
MCE Japan Authorized Agent: