CD74 Protein, Mouse (160a.a, HEK293, His)

The CD74 protein is significantly expressed in the thymus and lymph nodes, suggesting that it plays a key role in regulating immune system function. Its presence in the thymus, a key site for T cell development, underscores its important role in overseeing key cellular processes required for immune maturation. CD74 Protein, Mouse (160a.a, HEK293, His) is the recombinant mouse-derived CD74 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD74 Protein, Mouse (160a.a, HEK293, His) is 160 a.a., with molecular weight of 25-30 kDa.

The CD74 protein is integral to the MHC class II antigen processing pathway, exerting a critical role by stabilizing peptide-free class II alpha/beta heterodimers shortly after their synthesis. Furthermore, CD74 guides the transport of this complex from the endoplasmic reticulum to compartments where peptide loading onto class II molecules occurs. Beyond its involvement in antigen presentation, CD74 enhances T-cell responses through interaction with CD44. Additionally, CD74 acts as a chaperone for mature cathepsin L (CTSL), stabilizing its conformation by binding to the active site. This chaperone function aids in maintaining a pool of mature enzyme within endocytic compartments and the extracellular space of antigen-presenting cells (APCs), illustrating the multifaceted role of CD74 in modulating immune responses at various stages of antigen processing and presentation.

Mouse

HEK293

C-6*His

P04441-2 (Q56-L215)

16149  [NCBI]

QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGVTRQELGQVTL

25-30 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.