1. Recombinant Proteins
  2. CD Antigens Biotinylated Proteins
  3. B Cell CD Proteins
  4. Ig-β/CD79b
  5. CD79B Protein, Human (Biotinylated, HEK293, His-Avi)

CD79B Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P70768
Handling Instructions Technical Support

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag. The total length of CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is 131 a.a., with molecular weight of 30-40 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD79B protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag. The total length of CD79B Protein, Human (Biotinylated, HEK293, His-Avi) is 131 a.a., with molecular weight of 30-40 kDa.

Background

CD79B Protein plays an essential role in conjunction with CD79A in initiating the signal transduction cascade triggered by the B-cell antigen receptor complex (BCR). This pivotal function leads to the internalization of the complex, subsequent trafficking to late endosomes, and eventual antigen presentation. CD79B enhances the phosphorylation of CD79A, potentially by recruiting kinases that phosphorylate CD79A or by engaging proteins that bind to CD79A, safeguarding it from dephosphorylation. Forming a heterodimer with the alpha chain, CD79B forms a disulfide-linked complex. It is an integral component of the B-cell antigen receptor complex, where the alpha/beta chain heterodimer associates non-covalently with an antigen-specific membrane-bound surface immunoglobulin comprising two heavy chains and two light chains. Additionally, CD79B interacts with LYN, further contributing to its regulatory role in B-cell signaling.

Species

Human

Source

HEK293

Tag

C-Avi;C-6*His

Accession

P40259 (A29-D159)

Gene ID

974  [NCBI]

Molecular Construction
N-term
CD79B (A29-D159)
Accession # P40259
6*His-Avi
C-term
Synonyms
B-Cell Antigen Receptor Complex-Associated Protein Beta Chain; B-Cell-Specific Glycoprotein B29; Ig-Beta; Immunoglobulin-Associated B29 Protein; CD79b; CD79B; B29; IGB
AA Sequence

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Weight

30-40 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

CD79B Protein, Human (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD79B Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P70768
Quantity:
MCE Japan Authorized Agent: