1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins
  4. CD8b
  5. CD8 beta Protein, Human (HEK293, His)

CD8 beta Protein, Human (HEK293, His)

Cat. No.: HY-P72702
SDS COA Handling Instructions

CD8 beta is an important immune glycoprotein that serves as a coreceptor for MHC class I:peptide complexes, linking T cells to antigens presented by APCs. It interacts with TCR and MHC class I, recruits LCK kinase, and initiates multiple signaling pathways. CD8 beta Protein, Human (HEK293, His) is the recombinant human-derived CD8 beta protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD8 beta Protein, Human (HEK293, His) is 149 a.a., with molecular weight of 25-32 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $168 In-stock
50 μg $504 Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD8 beta is an important immune glycoprotein that serves as a coreceptor for MHC class I:peptide complexes, linking T cells to antigens presented by APCs. It interacts with TCR and MHC class I, recruits LCK kinase, and initiates multiple signaling pathways. CD8 beta Protein, Human (HEK293, His) is the recombinant human-derived CD8 beta protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD8 beta Protein, Human (HEK293, His) is 149 a.a., with molecular weight of 25-32 kDa.

Background

CD8 beta, an integral membrane glycoprotein, plays a pivotal role in the immune response, serving multiple functions against both external and internal threats. In T-cells, its primary function is as a coreceptor for the MHC class I molecule:peptide complex, where antigens presented by class I peptides originate from cytosolic proteins. CD8 beta interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen-presenting cells (APCs), recruiting the Src kinase LCK to the vicinity of the TCR-CD3 complex. The presence of a palmitoylation site in the cytoplasmic tail of the CD8B chain facilitates the partitioning of CD8 into plasma membrane lipid rafts, enriching signaling proteins. Once LCK is recruited, it initiates diverse intracellular signaling pathways, phosphorylating various substrates and leading to lymphokine production, motility, adhesion, and activation of cytotoxic T-lymphocytes (CTLs). CD8 beta also plays a critical role in the thymic selection of CD8+ T-cells. At the cell surface, it forms disulfide-linked heterodimers with CD8A and interacts with CD3D, coupling TCR-CD3 with CD8, and also interacts with LCK.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P10966-1 (L22-P170)

Gene ID

926  [NCBI]

Molecular Construction
N-term
CD8 beta (L22-P170)
Accession # P10966-1
6*His
C-term
Synonyms
T-Cell Surface Glycoprotein CD8 Beta Chain; CD8b; CD8B; CD8B1
AA Sequence

LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP

Molecular Weight

25-32 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD8 beta Protein, Human (HEK293, His)
Cat. No.:
HY-P72702
Quantity:
MCE Japan Authorized Agent: