2. Recombinant Proteins
  3. Immune Checkpoint Proteins CD Antigens
  4. Inhibitory Checkpoint Molecules Stimulatory Immune Checkpoint Molecules T Cell CD Proteins B Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins
  5. B7-1/CD80
  6. B7-1/CD80 Protein, Cynomolgus (HEK293, Fc)

B7-1/CD80 Protein, Cynomolgus (HEK293, Fc)

Cat. No.: HY-P7834
Handling Instructions

CD80 is a costimulatory cytokine for cancer immunity that is activated by binding to CD28 or CTLA-4. Tumor immune evasion occurs when CD80 expression is low. The increased expression of CD80 induced by TP53 stimulates anti-tumor immune responses. B7-1/CD80 Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived B7-1/CD80 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD80 is a costimulatory cytokine for cancer immunity that is activated by binding to CD28 or CTLA-4. Tumor immune evasion occurs when CD80 expression is low. The increased expression of CD80 induced by TP53 stimulates anti-tumor immune responses. B7-1/CD80 Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived B7-1/CD80 protein, expressed by HEK293 , with C-hFc labeled tag.
Background

CD80 is a membrane receptor and costimulatory cytokine used by immune cells to limit cancer progression. CD80 is activated by binding to CD28 or CTLA-4, thereby inducing T cell proliferation and cytokine production. The immune evasion mechanism of colon cancer is related to the low surface expression of CD80. When CD80 is upregulated on the surface of tumor cells, the anti-tumor immune response can be successfully activated. Normal expression levels of CD80 are frequently lost during tumor progression, possibly due to selective pressure from the immune system. TP53 is a regulator of CD80 expression in human cancer cells, and CD80 expression is strongly correlated with TP53 activation. TP53 induces antitumor immune responses through induction of CD80 in human cancer epithelial cells. CD80 serves as a receptor for adenovirus subtype B and may play a role in lupus neuropathy. CD80/CD86-conjugated adenovirus serotype 5 (Ad5)/3 chimeras improve expression and transduction efficiency with excellent transduction efficiency and low toxicity in brain tumors. Additionally, measurement of urinary CD80 excretion levels was able to differentiate between minimal change disease and focal segmental glomerulosclerosis in a mouse model of foot process effacement and human lupus nephritis.
Species

Cynomolgus
Source

HEK293
Tag

C-hFc
Accession

G7NXN7 (V35-N242)
Gene ID
Molecular Construction
N-term
B7-1 (V35-N242)
Accession # G7NXN7
hFc
C-term
Synonyms
rCynCD80/B7-1, Fc; T-lymphocyte activation antigen CD80; Activation B7-1 antigen; B7; CD80
AA Sequence

VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELNAISTTVSQDPETELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDN

Molecular Weight

70-90 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

B7-1/CD80 Protein, Cynomolgus (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
B7-1/CD80 Protein, Cynomolgus (HEK293, Fc)
Cat. No.:
HY-P7834
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.