1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. TAPA-1/CD81
  5. CD81 Protein, Cynomolgus/Rhesus Macaque (HEK293, His)

CD81 Protein, Cynomolgus/Rhesus Macaque (HEK293, His)

Cat. No.: HY-P76244
SDS COA Handling Instructions Technical Support

The CD81 protein is a member of the growth hormone/prolactin family and regulates a variety of physiological processes. Prolactin is mainly associated with mammary gland development and lactation, has pleiotropic effects, and affects immune responses, metabolism, and behavior. CD81 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD81 protein, expressed by HEK293 , with N-His labeled tag. The total length of CD81 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is 86 a.a., with molecular weight of ~10 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD81 protein is a member of the growth hormone/prolactin family and regulates a variety of physiological processes. Prolactin is mainly associated with mammary gland development and lactation, has pleiotropic effects, and affects immune responses, metabolism, and behavior. CD81 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD81 protein, expressed by HEK293 , with N-His labeled tag. The total length of CD81 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is 86 a.a., with molecular weight of ~10 KDa.

Background

Prolactin is a member of the somatotropin/prolactin family, playing a crucial role in regulating various physiological processes. As a hormone, prolactin is primarily associated with the modulation of mammary gland development and lactation in mammals. Beyond its reproductive functions, prolactin also exhibits pleiotropic effects, influencing immune responses, metabolism, and behavior. The somatotropin/prolactin family encompasses proteins that share structural and functional similarities, reflecting their evolutionary relationship and involvement in diverse biological pathways. Prolactin's versatility highlights its significance in orchestrating a range of physiological functions, making it a key player in maintaining homeostasis in different tissues and systems.

Biological Activity

Immobilized Cynomolgus CD81 at 2 μg/mL (100 μL/well) can bind Anti-CD81 Antibody, The ED50 for this effect is 5.314 ng/mL.

  • Immobilized Cynomolgus CD81 at 2 μg/mL (100 μL/well) can bind Anti-CD81 Antibody, The ED50 for this effect is 5.314 ng/mL.
Species

Rhesus Macaque/Cynomolgus

Source

HEK293

Tag

N-6*His

Accession

A0A2K5UDJ9 (K116-K201)

Gene ID
Molecular Construction
N-term
His
CD81 (K116-K201)
Accession # A0A2K5UDJ9
C-term
Synonyms
CD81 antigen; CD81; CVID6; TAPA-1; TSPAN28
AA Sequence

KDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLAALTTSVLKNNLCPSGSNIISNLLKKDCHQKIDELFSGK

Molecular Weight

Approximately 10 kDa.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD81 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD81 Protein, Cynomolgus/Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P76244
Quantity:
MCE Japan Authorized Agent: