1. Recombinant Proteins
  2. CD Antigens
  3. Platelet CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins Signal Transduction-related CD Proteins
  4. CD82
  5. CD82 Protein, Human (HEK293, Fc)

CD82 Protein, Human (HEK293, Fc)

Cat. No.: HY-P72705
COA Handling Instructions

CD82, a vital immune response participant, engages with CD4 or CD8 to provide crucial costimulatory signals in the TCR/CD3 pathway. Its direct interaction with IGSF8 plays a pivotal role in modulating immune functions and mediating cellular responses. CD82 Protein, Human (HEK293, Fc) is the recombinant human-derived CD82 protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $200 In-stock
50 μg $565 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD82, a vital immune response participant, engages with CD4 or CD8 to provide crucial costimulatory signals in the TCR/CD3 pathway. Its direct interaction with IGSF8 plays a pivotal role in modulating immune functions and mediating cellular responses. CD82 Protein, Human (HEK293, Fc) is the recombinant human-derived CD82 protein, expressed by HEK293 , with N-hFc labeled tag.

Background

As a critical participant in immune responses, CD82 associates with CD4 or CD8, delivering essential costimulatory signals within the TCR/CD3 pathway. Through direct interaction with IGSF8, CD82 plays a pivotal role in modulating immune functions and mediating cellular responses.

Species

Human

Source

HEK293

Tag

N-hFc

Accession

P27701-1 (G103-Q225)

Gene ID
Molecular Construction
N-term
hFc
CD82 (G103-Q225)
Accession # P27701-1
C-term
Synonyms
CD82 antigen; C33 antigen; Tspan-27; CD82; KAI1; SAR2; ST6; TSPAN27
AA Sequence

GALFYFNMGKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQ

Molecular Weight

40-60 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD82 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P72705
Quantity:
MCE Japan Authorized Agent: