1. Recombinant Proteins
  2. CD Antigens Biotinylated Proteins
  3. B Cell CD Proteins Monocyte CD Proteins Signal Transduction-related CD Proteins
  4. CD84
  5. CD84/SLAMF5 Protein, Human (Biotinylated, HEK293, His-Avi)

CD84/SLAMF5 Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P72414
Handling Instructions Technical Support

CD84/SLAMF5 protein is a self-ligand receptor in the SLAM family that regulates the activities of various immune cells through homotypic or heterotypic cell-cell interactions. It fine-tunes its function based on the presence or absence of small cytoplasmic adapter proteins, including SH2D1A/SAP and/or SH2D1B/EAT-2. CD84/SLAMF5 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD84/SLAMF5 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag. The total length of CD84/SLAMF5 Protein, Human (Biotinylated, HEK293, His-Avi) is 199 a.a., with molecular weight of 40-50 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD84/SLAMF5 protein is a self-ligand receptor in the SLAM family that regulates the activities of various immune cells through homotypic or heterotypic cell-cell interactions. It fine-tunes its function based on the presence or absence of small cytoplasmic adapter proteins, including SH2D1A/SAP and/or SH2D1B/EAT-2. CD84/SLAMF5 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD84/SLAMF5 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag. The total length of CD84/SLAMF5 Protein, Human (Biotinylated, HEK293, His-Avi) is 199 a.a., with molecular weight of 40-50 kDa.

Background

The CD84/SLAMF5 protein serves as a self-ligand receptor within the signaling lymphocytic activation molecule (SLAM) family, engaging in homo- or heterotypic cell-cell interactions that modulate the activation and differentiation of diverse immune cells, contributing to the intricate regulation and interconnection of both innate and adaptive immune responses. The protein's activities are finely tuned by the presence or absence of small cytoplasmic adapter proteins, including SH2D1A/SAP and/or SH2D1B/EAT-2. CD84/SLAMF5 can mediate natural killer (NK) cell cytotoxicity, dependent on both SH2D1A and SH2D1B. It enhances proliferative responses of activated T-cells, and SH2D1A/SAP appears not to be required for this process. Homophilic interactions amplify interferon gamma/IFNG secretion in lymphocytes and induce platelet stimulation via a SH2D1A-dependent pathway. The protein may serve as a marker for hematopoietic progenitor cells. Essential for prolonged T-cell:B-cell contact, optimal T follicular helper function, and germinal center formation, CD84/SLAMF5 in germinal centers contributes to maintaining B-cell tolerance and preventing autoimmunity. In mast cells, it negatively regulates high-affinity immunoglobulin epsilon receptor signaling, independently of SH2D1A and SH2D1B but implicating FES and PTPN6/SHP-1. In macrophages, it positively regulates LPS-induced MAPK phosphorylation and NF-kappaB activation, modulating LPS-induced cytokine secretion. Additionally, CD84/SLAMF5 positively regulates macroautophagy in primary dendritic cells through the stabilization of IRF8 and inhibits TRIM21-mediated proteasomal degradation of IRF8. The protein forms homodimers via its extracellular domain and interacts with CD48 molecules from other cells in a head-to-tail dimeric arrangement. It also interacts with SH2 domain-containing proteins, including SH2D1A/SAP and SH2D1B/EAT-2, and tyrosine-protein phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 via its phosphorylated cytoplasmic domain, with the latter interaction blocked by SH2D1A. CD84/SLAMF5 further interacts with INPP5D/SHIP1 through its phosphorylated ITSM domains.

Species

Human

Source

HEK293

Tag

C-Avi;C-6*His

Accession

Q9UIB8-1 (K22-R220)

Gene ID
Molecular Construction
N-term
CD84 (K22-R220)
Accession # Q9UIB8-1
6*His-Avi
C-term
Synonyms
SLAM family member 5; Cell surface antigen MAX.3; Hly9-beta; Signaling lymphocytic activation molecule 5; CD84
AA Sequence

KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFR

Molecular Weight

40-50 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CD84/SLAMF5 Protein, Human (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD84/SLAMF5 Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P72414
Quantity:
MCE Japan Authorized Agent: