B7-2/CD86 Protein, Human (HEK293, His)

B7-2/CD86 protein negatively regulates T-cell activation by disrupting CD86 cluster formation, modulating the T-cell response, and influencing immune activation. B7-2/CD86 Protein, Human (HEK293, His) is the recombinant human-derived B7-2/CD86 protein, expressed by HEK293 , with C-6*His labeled tag.

B7-2/CD86 protein functions as a negative regulator of T-cell activation by disrupting the formation of CD86 clusters. Through this interference, it modulates the T-cell response and plays a role in regulating immune activation.

Human

HEK293

C-6*His

P42081 (A24-P247)

942  [NCBI]

APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP

57-66 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.