CD8 alpha Protein, Human (HEK293, His)

CD8 alpha Protein is expressed on the surface of cytotoxic T cells. It plays a crucial role in immune responses by binding to major histocompatibility complex class I molecules on target cells, enhancing T cell activation and cytotoxicity. CD8 alpha Protein is also involved in immune regulation and tolerance. Understanding its functions can aid in developing immunotherapies and vaccines. CD8 alpha Protein, Human (HEK293, His) is the recombinant human-derived CD8 alpha protein, expressed by HEK293 , with N-6*His labeled tag. The total length of CD8 alpha Protein, Human (HEK293, His) is 161 a.a., with molecular weight of ~28 kDa.

CD8 alpha, an integral membrane glycoprotein, plays a pivotal role in orchestrating immune responses against both external and internal threats. In T-cells, it serves as a coreceptor for MHC class I molecule:peptide complexes, facilitating the recognition of antigens derived from cytosolic proteins. Simultaneously interacting with the T-cell receptor (TCR) and MHC class I proteins on antigen-presenting cells (APCs), CD8 alpha recruits the Src kinase LCK to the TCR-CD3 complex, initiating intracellular signaling pathways that culminate in lymphokine production, cellular motility, adhesion, and activation of cytotoxic T-lymphocytes (CTLs). This mechanism empowers CTLs to identify and eliminate infected or tumor cells. In NK-cells, CD8 alpha homodimers at the cell surface contribute to a survival mechanism, enabling the conjugation and lysis of multiple target cells. Moreover, CD8 alpha homodimers promote the survival and differentiation of activated lymphocytes into memory CD8 T-cells. The protein forms disulfide-linked heterodimers with CD8B on the cell surface and homodimers in various cell types, including NK-cells and peripheral blood T-lymphocytes. Interactions with the MHC class I HLA-A/B2M dimer and LCK, as well as its direct interaction with HLA-G, highlight the intricate network of molecular associations that underlie CD8 alpha's diverse functions in immune regulation.

Human

HEK293

N-6*His

P01732 (S22-D182)

925  [NCBI]

SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

Approximately 28 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.