1. Recombinant Proteins
  2. CD Antigens Complement System
  3. B Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Platelet CD Proteins Dendritic Cell CD Proteins Endothelial cell CD Proteins Complement Receptor
  4. CD93
  5. CD93/C1qR1 Protein, Macaca fascicularis (HEK293, His)

CD93/C1qR1 Protein, Macaca fascicularis (HEK293, His)

Cat. No.: HY-P700464
Handling Instructions Technical Support

CD93/C1qR1 Protein lacks conserved residue(s) crucial for feature annotation propagation. CD93/C1qR1 Protein, Macaca fascicularis (HEK293, His) is the recombinant cynomolgus-derived CD93/C1qR1 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of CD93/C1qR1 Protein, Macaca fascicularis (HEK293, His) is 558 a.a., with molecular weight of 60.2 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD93/C1qR1 Protein lacks conserved residue(s) crucial for feature annotation propagation. CD93/C1qR1 Protein, Macaca fascicularis (HEK293, His) is the recombinant cynomolgus-derived CD93/C1qR1 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of CD93/C1qR1 Protein, Macaca fascicularis (HEK293, His) is 558 a.a., with molecular weight of 60.2 kDa.

Background

The CD93/C1qR1 protein is characterized by a deficiency in conserved residue(s) crucial for the propagation of feature annotation.

Species

Cynomolgus

Source

HEK293

Tag

C-10*His

Accession

A0A2K5VH53 (A24-L581)

Gene ID
Molecular Construction
N-term
C1qR1 (A24-L581)
Accession # A0A2K5VH53
10*His
C-term
Synonyms
rHuCD93, His; Complement Component C1q Receptor; Matrix-Remodeling-Associated Protein 4CD93; CD93
AA Sequence

ADTEAVVCAGTACYTAHWGKLSAAEAQNLCLQNGGNLATVKSEEEAQHVQQVLAQLLRREAALTARMGKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPGRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDDSQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCIPGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGSFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTEGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFRCGCLPGWVLAPNGVSCAMGPVSLGPPSGPPDEEYKGEREGSTVPPAATASPTRGPEGTPKSTPTTRRPLLSSDAPITSVPLEVLAPSGSPGLWREPSIHHTTAASGAQEPAGGDSSVATQNDDGTDGQKL

Molecular Weight

60.2 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD93/C1qR1 Protein, Macaca fascicularis (HEK293, His)
Cat. No.:
HY-P700464
Quantity:
MCE Japan Authorized Agent: