1. Recombinant Proteins
  2. CD Antigens
  3. NK Cell CD Proteins Platelet CD Proteins Erythrocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins Cell Adhesion-related CD Proteins
  4. CD99/MIC2
  5. CD99 Protein, Rat (HEK293, Fc)

CD99 Protein, Rat (HEK293, Fc)

Cat. No.: HY-P75365
SDS COA Handling Instructions

CD99 protein is a member of the CD99 family and plays a key role in several important cellular processes such as immune response, cell adhesion and migration. It exerts a major influence on lymphocyte trafficking and is involved in the regulation of immune cell interactions. CD99 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD99 Protein, Rat (HEK293, Fc) is 103 a.a., with molecular weight of ~48 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $45 In-stock
10 μg $70 In-stock
50 μg $180 In-stock
100 μg $290 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

CD99 Protein, Rat (HEK293, Fc) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD99 protein is a member of the CD99 family and plays a key role in several important cellular processes such as immune response, cell adhesion and migration. It exerts a major influence on lymphocyte trafficking and is involved in the regulation of immune cell interactions. CD99 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD99 Protein, Rat (HEK293, Fc) is 103 a.a., with molecular weight of ~48 kDa.

Background

CD99 Protein, a member of the CD99 family, is a key player in several important cellular processes, including immune responses, cell adhesion, and migration. It exerts significant influence on lymphocyte trafficking and is involved in the regulation of immune cell interactions. CD99 Protein is known to be expressed on various immune cells, where it contributes to the formation of immunological synapses and facilitates the communication between different immune cells. Additionally, CD99 Protein is implicated in cell adhesion and migration processes, playing a crucial role in the transmigration of leukocytes across endothelial cell barriers. Through its multifaceted functions, CD99 Protein is essential for the proper functioning of the immune system and the coordination of immune responses.

Biological Activity

Measured by its ability to chemoattract U87 cells. The ED50 for this effect is 21.43 ng/mL, corresponding to a specific activity is 4.67×104 U/mg.

  • Measured by its ability to chemoattract U87 cells. The ED50 for this effect is 21.43 ng/mL, corresponding to a specific activity is 4.67×104 U/mg.
Species

Rat

Source

HEK293

Tag

C-hFc

Accession

B4F7A5 (D25-G127)

Gene ID
Molecular Construction
N-term
CD99 (D25-G127)
Accession # B4F7A5
hFc
C-term
Synonyms
CD99 Antigen; 12E7; E2 Antigen; Protein MIC2; T-Cell Surface Glycoprotein E2; CD99; MIC2; MIC2X; MIC2Y
AA Sequence

DGDFRLDDALEDTDKKPTPKPPTPKKPSSGDFDLEEALTGGADEDPRRPGSRPKPDPKPPGPPRDSGGISDRDLEDVAGHGGRGGGAGDRGTDGAESEGQPQG

Molecular Weight

Approximately 48 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD99 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P75365
Quantity:
MCE Japan Authorized Agent: