CD99L2 Protein, Human (HEK293, His)

The CD99L2 protein plays a critical role in late leukocyte extravasation, helping cells to overcome the endothelial basement membrane. It acts independently at the same site as PECAM1, coordinating but uniquely participating in the complex process of leukocyte migration. CD99L2 Protein, Human (HEK293, His) is the recombinant human-derived CD99L2 protein, expressed by HEK293 , with C-6*His labeled tag.

CD99L2 assumes a crucial role in facilitating a late stage of leukocyte extravasation, aiding cells in overcoming the endothelial basement membrane. Its actions occur at the same site as PECAM1, albeit independently, suggesting a coordinated yet distinct contribution to the intricate process of leukocyte transmigration. Serving as a homophilic adhesion molecule, CD99L2 engages in interactions that, while homophilic in nature, may not be imperative for cell aggregation, underscoring the complexity of its involvement in cellular adhesive events.

Human

HEK293

C-6*His

Q8TCZ2-1 (D26-A188)

83692  [NCBI]

DFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSGLDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEPGTIA

25-55 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.