CDK2AP2 Protein, Human (HEK293, His)

CDK2AP2 protein, a vital component of the NuRD complex, actively engages in chromatin remodeling. It inhibits G1/S phase transition by suppressing CDK2, impeding CDK2's interaction with cyclin E or A. Beyond cell cycle control, CDK2AP2 is crucial for ESC self-renewal, ensuring survival during differentiation, and regulates microtubule organization in metaphase II oocytes. Part of the NuRD complex, CDK2AP2 collaborates with proteins like MTA1, MTA2, HDAC1, and others, showcasing its multifaceted regulatory functions. CDK2AP2 Protein, Human (HEK293, His) is the recombinant human-derived CDK2AP2 protein, expressed by HEK293, with C-6*His labeled tag. The total length of CDK2AP2 Protein, Human (HEK293, His) is 126 a.a., with molecular weight of ~26.0 kDa.

CDK2AP2 protein functions as a key component of the histone deacetylase NuRD complex, actively participating in chromatin remodeling. Its regulatory role extends to inhibiting the G1/S phase transition in the cell cycle by suppressing CDK2 expression and activation, achieved through interference with the interaction between CDK2 and cyclin E or A. Beyond cell cycle control, CDK2AP2 plays a crucial role in the self-renewal of embryonic stem cells (ESCs) and ensures cell survival during the terminal differentiation of ESCs. Additionally, it contributes to the regulation of microtubule organization in metaphase II oocytes. As part of the NuRD repressor complex, CDK2AP2 collaborates with various core and peripherally associated proteins, including MTA1, MTA2, MTA3, RBBP4, RBBP7, HDAC1, HDAC2, MBD2, MBD3, CDK2AP1, GATAD2A, GATAD2B, CHD3, CHD4, and CHD5. Interactions with CDK2AP1, CDK2, and MAPK1 further underline its multifaceted regulatory functions.

Human

HEK293

C-6*His

O75956 (M1-T126)

10263  [NCBI]

MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART

Approximately 26.0 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.