1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Cyclin-Dependent Kinase Inhibitor Proteins
  4. Cyclin Dependent Kinase 4 Inhibitor C (CDKN2C)
  5. CDKN2C Protein, Human (His)

The CDKN2C protein (also known as p18) interacts strongly with CDK6 and weakly with CDK4. Its functional effects inhibit cell growth and proliferation and are significantly related to the presence of endogenous retinoblastoma protein RB. CDKN2C Protein, Human (His) is the recombinant human-derived CDKN2C protein, expressed by E. coli , with N-6*His labeled tag. The total length of CDKN2C Protein, Human (His) is 168 a.a., with molecular weight of ~17.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CDKN2C protein (also known as p18) interacts strongly with CDK6 and weakly with CDK4. Its functional effects inhibit cell growth and proliferation and are significantly related to the presence of endogenous retinoblastoma protein RB. CDKN2C Protein, Human (His) is the recombinant human-derived CDKN2C protein, expressed by E. coli , with N-6*His labeled tag. The total length of CDKN2C Protein, Human (His) is 168 a.a., with molecular weight of ~17.0 kDa.

Background

The CDKN2C protein, also known as p18, exerts strong interactions with CDK6 and exhibits a weaker interaction with CDK4. Its functional impact manifests in the inhibition of cell growth and proliferation, with a noteworthy correlation dependent on the presence of the endogenous retinoblastoma protein RB. The formation of a heterodimeric complex between p18 and CDK6 underscores its role as a regulator in cell cycle progression. This interaction highlights the significance of CDKN2C in modulating key cellular processes, particularly in controlling the activity of cyclin-dependent kinases and influencing the dynamics of cell proliferation.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P42773 (M1-Q168)

Gene ID
Molecular Construction
N-term
6*His
CDKN2C (M1-Q168)
Accession # P42773
C-term
Synonyms
rHuCyclin-dependent kinase 4 inhibitor C/CDKN2C, His; Cyclin-Dependent Kinase 4 Inhibitor C; Cyclin-Dependent Kinase 6 Inhibitor; p18-INK4c; p18-INK6; CDKN2C; CDKN6
AA Sequence

MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ

Molecular Weight

Approximately 17.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CDKN2C Protein, Human (His)
Cat. No.:
HY-P70034
Quantity:
MCE Japan Authorized Agent: