CDKN2C Protein, Human (His)

The CDKN2C protein (also known as p18) interacts strongly with CDK6 and weakly with CDK4. Its functional effects inhibit cell growth and proliferation and are significantly related to the presence of endogenous retinoblastoma protein RB. CDKN2C Protein, Human (His) is the recombinant human-derived CDKN2C protein, expressed by E. coli , with N-6*His labeled tag. The total length of CDKN2C Protein, Human (His) is 168 a.a., with molecular weight of ~17.0 kDa.

The CDKN2C protein, also known as p18, exerts strong interactions with CDK6 and exhibits a weaker interaction with CDK4. Its functional impact manifests in the inhibition of cell growth and proliferation, with a noteworthy correlation dependent on the presence of the endogenous retinoblastoma protein RB. The formation of a heterodimeric complex between p18 and CDK6 underscores its role as a regulator in cell cycle progression. This interaction highlights the significance of CDKN2C in modulating key cellular processes, particularly in controlling the activity of cyclin-dependent kinases and influencing the dynamics of cell proliferation.

Human

E. coli

N-6*His

P42773 (M1-Q168)

1031  [NCBI]

MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ

Approximately 17.0 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.