CEACAM19 Protein, Human (HEK293, His)

CEACAM19 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM19 protein, expressed by HEK293 , with C-His labeled tag. The total length of CEACAM19 Protein, Human (HEK293, His) is 157 a.a., with molecular weight of ~15.4 KDa.

Measured by the ability of the immobilized protein to support the adhesion of the L929 cells. The ED₅₀ for this effect is 0.5232 μg/mL, corresponding to a specific activity is 1.911×10³ units/mg.

• 
  Measured by the ability of the immobilized protein to support the adhesion of the L929 cells. The ED₅₀ for this effect is 0.5232 μg/mL, corresponding to a specific activity is 1.911×10³ units/mg.

Human

HEK293

C-6*His

Q7Z692-1 (A33-G157)

56971  [NCBI]

ALYIQKIPEQPQKNQDLLLSVQGVPDTFQDFNWYLGEETYGGTRLFTYIPGIQRPQRDGSAMGQRDIVGFPNGSMLLRRAQPTDSGTYQVAITINSEWTMKAKTEVQVAEKNKELPSTHLPTNAG

Approximately 18-24 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.