CEBP delta/CEBPD Protein, Human (His-Myc)

The CEBP delta/CEBPD protein is a transcriptional activator that recognizes CCAAT and enhanced core motifs. It is critical for immune and inflammatory response genes and enhances IL6 transcription independently or together with CEBPB. CEBP delta/CEBPD Protein, Human (His-Myc) is the recombinant human-derived CEBP delta/CEBPD protein, expressed by E. coli , with N-10*His, C-Myc labeled tag. The total length of CEBP delta/CEBPD Protein, Human (His-Myc) is 268 a.a., with molecular weight of ~43 kDa.

The CEBP delta/CEBPD protein serves as a transcription activator, recognizing two distinct DNA motifs: the CCAAT homology found in many promoters and the enhanced core homology prevalent in enhancers. This transcription factor plays a crucial role in regulating the expression of genes associated with immune and inflammatory responses. Functioning both as a homodimer and a heterodimer, CEBP delta enhances IL6 transcription independently and as a heterodimer with CEBPB. Additionally, it can form stable heterodimers not only with CEBPB but also with CEBPA and CEBPE. Notably, CEBP delta directly interacts with SPI1/PU.1, and this interaction does not impact the DNA-binding properties of each partner. Furthermore, CEBP delta engages in an interaction with PRDM16, further highlighting its versatile role in transcriptional regulation.

Human

E. coli

N-10*His;C-Myc

P49716 (S2-R269)

1052  [NCBI]

SAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR

Approximately 43 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.