1. Recombinant Proteins
  2. Others
  3. CEBP delta/CEBPD Protein, Human (His-Myc)

The CEBP delta/CEBPD protein is a transcriptional activator that recognizes CCAAT and enhanced core motifs. It is critical for immune and inflammatory response genes and enhances IL6 transcription independently or together with CEBPB. CEBP delta/CEBPD Protein, Human (His-Myc) is the recombinant human-derived CEBP delta/CEBPD protein, expressed by E. coli , with N-10*His, C-Myc labeled tag. The total length of CEBP delta/CEBPD Protein, Human (His-Myc) is 268 a.a., with molecular weight of ~43 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CEBP delta/CEBPD protein is a transcriptional activator that recognizes CCAAT and enhanced core motifs. It is critical for immune and inflammatory response genes and enhances IL6 transcription independently or together with CEBPB. CEBP delta/CEBPD Protein, Human (His-Myc) is the recombinant human-derived CEBP delta/CEBPD protein, expressed by E. coli , with N-10*His, C-Myc labeled tag. The total length of CEBP delta/CEBPD Protein, Human (His-Myc) is 268 a.a., with molecular weight of ~43 kDa.

Background

The CEBP delta/CEBPD protein serves as a transcription activator, recognizing two distinct DNA motifs: the CCAAT homology found in many promoters and the enhanced core homology prevalent in enhancers. This transcription factor plays a crucial role in regulating the expression of genes associated with immune and inflammatory responses. Functioning both as a homodimer and a heterodimer, CEBP delta enhances IL6 transcription independently and as a heterodimer with CEBPB. Additionally, it can form stable heterodimers not only with CEBPB but also with CEBPA and CEBPE. Notably, CEBP delta directly interacts with SPI1/PU.1, and this interaction does not impact the DNA-binding properties of each partner. Furthermore, CEBP delta engages in an interaction with PRDM16, further highlighting its versatile role in transcriptional regulation.

Species

Human

Source

E. coli

Tag

N-10*His;C-Myc

Accession

P49716 (S2-R269)

Gene ID
Molecular Construction
N-term
10*His
CEBPD (S2-R269)
Accession # P49716
C-term
Synonyms
C/EBP delta; C/EBP related protein 3; CCAAT/enhancer binding protein C/EBP; delta; CCAAT/enhancer binding protein delta; CCAAT/enhancer-binding protein delta; CEBP D; CEBPD; CEBPD_HUMAN; CELF; Crp 3; Crp3; NF IL6 beta; NF-IL6-beta; Nuclear factor NF IL6 beta; Nuclear factor NF-IL6-beta
AA Sequence

SAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR

Molecular Weight

Approximately 43 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CEBP delta/CEBPD Protein, Human (His-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CEBP delta/CEBPD Protein, Human (His-Myc)
Cat. No.:
HY-P72134
Quantity:
MCE Japan Authorized Agent: