CELA3A Protein, Human (HEK293, His)

CELA3A Protein, an efficient alanine-specific protease, exhibits minimal elastolytic activity. CELA3A Protein, Human (HEK293, His) is the recombinant human-derived CELA3A protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CELA3A Protein, Human (HEK293, His) is 255 a.a., with molecular weight of ~31.0 kDa.

CELA3A Protein functions as an efficient protease with a specificity for alanine, demonstrating limited elastolytic activity.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

C-6*His

P09093 (S16-H270)

10136  [NCBI]

SGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIASH

Approximately 31.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 10% Glycerol, pH 7.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.