CEP57 Protein, Human (His)

CEP57 is a centrosomal protein that is a potential player in promoting microtubule attachment to centrosomes, possibly by forming a ring-like structure around microtubules. The protein exhibits homodimer and homooligomer formation and interacts with microtubules. CEP57 Protein, Human (GST) is the recombinant human-derived CEP57 protein, expressed by E. coli , with N-GST labeled tag. The total length of CEP57 Protein, Human (GST) is 109 a.a., with molecular weight of 35-43 kDa.

CEP57 (Centrosomal Protein 57) is a centrosomal protein with a potential role in microtubule attachment to centrosomes, possibly by forming ring-like structures around microtubules. Its involvement extends to mediating the nuclear translocation and mitogenic activity of the internalized growth factor FGF2, distinguishing its interaction from that of FGF1. CEP57 exists as a homodimer and homooligomer, and it interacts with microtubules, as well as with FGF2 and RAP80. Notably, it does not exhibit interaction with FGF1 or the 24 kDa isoform of FGF2. These features suggest that CEP57 plays a multifaceted role in cellular processes, including microtubule dynamics and the regulation of growth factor-mediated signaling pathways. It has to outline CEP57's potential functions in microtubule attachment, interaction with growth factors, and its oligomeric nature.

Human

E. coli

N-6*His

Q86XR8 (S118-R226)

9702  [NCBI]

SKNEESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKR

Approximately 14 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.