CG beta 3 Protein, Human (HEK293, His)

CG beta 3 Protein, Human(HEK 293, His) is a member of the glycoprotein hormone beta chain family and encodes the beta 3 subunit of chorionic gonadotropin (CG).

Chorionic gonadotropin (CG) is a placental hormone that stimulates steroidogenesis and maintains the corpus luteum of pregnancy. CG comprises noncovalently bound α and, β subunits that are encoded by separate genes. Southern blot analyses indicate that there are six CGβ, genes and a single copy of the luteinizing hormone (LHP) gene clustered within a 60-kilobase (kb) region of chromosome 19. Transcriptional activation of the chorionic gonadotropin (CG) genes is linked to trophoblast differentiation. In a multistep process, cytotrophoblasts expressing only the alpha subunit differentiate into intermediates that coexpress the CG beta subunit^[1][2].

Human

HEK293

C-6*His

P0DN86 (S21-Q165)

1082  [NCBI]

SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ

28-35 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. J L Jameson, et al. Isolation and characterization of the human chorionic gonadotropin beta subunit (CG beta) gene cluster: regulation of transcriptionally active CG beta gene by cyclic AMP. Mol Cell Biol. 1988 Dec;8(12):5100-7.  [Content Brief]

  [2]. B L Strauss, et al. Expression of the beta subunit of chorionic gonadotropin in transgenic mice. J Biol Chem. 1994 Feb 18;269(7):4968-73.  [Content Brief]