cGB-PDE Protein, Mouse (Myc, His)

cGB-PDE protein regulates signal transduction by specifically hydrolyzing cto 5'-GMP, thereby controlling the intracellular concentration of cyclic nucleotides, particularly nitric-oxide-generated cGMP. cGB-PDE Protein, Mouse (Myc, His) is the recombinant mouse-derived cGB-PDE protein, expressed by E. coli , with N-His, C-Myc labeled tag.

The cGB-PDE protein serves a vital function in signal transduction by modulating the intracellular levels of cyclic nucleotides. This phosphodiesterase plays a specific role in catalyzing the hydrolysis of cGMP, converting it to 5'-GMP. Notably, cGB-PDE is particularly involved in the regulation of cgenerated by nitric oxide.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Mouse

E. coli

N-His;C-Myc

Q8CG03 (D154-N320)

242202  [NCBI]

DVTALCHKIFLHIHGLISADRYSLFLVCEDSSKDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRN

Approximately 29 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.