Chemerin/RARRES2 Protein, Mouse (HEK293, Fc)

Chemerin/RARRES2 proteins bind to signaling receptors and are involved in various processes, including promotion of adipocyte differentiation, protein phosphorylation, and insulin receptor signaling. It plays a role in brown adipocyte differentiation and is located in the extracellular region. Chemerin/RARRES2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Chemerin/RARRES2 protein, expressed by HEK293 , with C-hFc labeled tag.

The Chemerin/RARRES2 protein is predicted to possess signaling receptor binding activity and is involved in various processes, including positive regulation of fat cell differentiation, positive regulation of protein phosphorylation, and regulation of insulin receptor signaling pathway. It acts upstream of or within brown fat cell differentiation and is located in the extracellular region. Chemerin/RARRES2 is expressed in the genitourinary system and retina and shares orthology with human RARRES2 (retinoic acid receptor responder 2). Biased expression of Chemerin/RARRES2 is observed in adult liver (RPKM 313.8), placenta (RPKM 166.0), and 12 other tissues, according to the Alliance of Genome Resources in April 2022.

Measured in a cell proliferation assay using HUVEC cells. The ED50 for this effect is 8.674 ng/mL, corresponding to a specific activity is 1.15×10^5 units/mg.

• 
  Measured in a cell proliferation assay using HUVEC cells. The ED₅₀ for this effect is 8.674 ng/mL, corresponding to a specific activity is 1.15×10⁵ units/mg.

Mouse

HEK293

C-hFc

Q9DD06/NP_082128.1 (T17-S156)

71660  [NCBI]

TRGTEPELSETQRRSLQVALEEFHKHPPVQLAFQEIGVDRAEEVLFSAGTFVRLEFKLQQTNCPKKDWKKPECTIKPNGRRRKCLACIKMDPKGKILGRIVHCPILKQGPQDPQELQCIKIAQAGEDPHGYFLPGQFAFS

Approximately 42.6 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.