Chlorite Dismutase/Cld Protein, Dechloromonas aromatica (His)

Chlorite dismutase/Cld protein is a key enzyme in cellular metabolism that catalyzes the conversion of chlorite into chloride and oxygen. This enzyme activity plays a key role in the detoxification of chlorite, a harmful compound used in various industrial processes. Chlorite Dismutase/Cld Protein, Dechloromonas aromatica (His) is the recombinant Chlorite Dismutase/Cld protein, expressed by E. coli , with N-6*His labeled tag. The total length of Chlorite Dismutase/Cld Protein, Dechloromonas aromatica (His) is 248 a.a., with molecular weight of ~32.0 kDa.

BBOX1 protein plays a pivotal role in cellular metabolism by catalyzing the formation of L-carnitine from gamma-butyrobetaine. This enzymatic activity is a crucial step in the carnitine biosynthetic pathway, contributing to the synthesis of L-carnitine, an essential molecule involved in the transport of fatty acids into the mitochondria for β-oxidation. BBOX1's function in this pathway is instrumental for maintaining cellular energy homeostasis, as L-carnitine serves as a cofactor in fatty acid metabolism, facilitating their efficient utilization as a source of energy. The catalytic activity of BBOX1 underscores its significance in regulating key metabolic processes and highlights its role as a key player in cellular energy metabolism.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Others

E. coli

N-6*His

Q47CX0 (M35-D282)

/

MQPMQSMKIERGTILTQPGVFGVFTMFKLRPDWNKVPVAERKGAAEEVKKLIEKHKDNVLVDLYLTRGLETNSDFFFRINAYDLAKAQTFMREFRSTTVGKNADVFETLVGVTKPLNYISKDKSPGLNAGLSSATYSGPAPRYVIVIPVKKNAEWWNMSPEERLKEMEVHTTPTLAYLVNVKRKLYHSTGLDDTDFITYFETDDLTAFNNLMLSLAQVKENKFHVRWGSPTTLGTIHSPEDVIKALAD

Approximately 32.0 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 0.5 mM EDTA, 4% sucrose, 0.02% Tween 80, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.