1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. Chlorite Dismutase/Cld Protein, Dechloromonas aromatica (His)

Chlorite Dismutase/Cld Protein, Dechloromonas aromatica (His)

Cat. No.: HY-P70068
Handling Instructions Technical Support

Chlorite dismutase/Cld protein is a key enzyme in cellular metabolism that catalyzes the conversion of chlorite into chloride and oxygen. This enzyme activity plays a key role in the detoxification of chlorite, a harmful compound used in various industrial processes. Chlorite Dismutase/Cld Protein, Dechloromonas aromatica (His) is the recombinant Chlorite Dismutase/Cld protein, expressed by E. coli , with N-6*His labeled tag. The total length of Chlorite Dismutase/Cld Protein, Dechloromonas aromatica (His) is 248 a.a., with molecular weight of ~32.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Chlorite dismutase/Cld protein is a key enzyme in cellular metabolism that catalyzes the conversion of chlorite into chloride and oxygen. This enzyme activity plays a key role in the detoxification of chlorite, a harmful compound used in various industrial processes. Chlorite Dismutase/Cld Protein, Dechloromonas aromatica (His) is the recombinant Chlorite Dismutase/Cld protein, expressed by E. coli , with N-6*His labeled tag. The total length of Chlorite Dismutase/Cld Protein, Dechloromonas aromatica (His) is 248 a.a., with molecular weight of ~32.0 kDa.

Background

BBOX1 protein plays a pivotal role in cellular metabolism by catalyzing the formation of L-carnitine from gamma-butyrobetaine. This enzymatic activity is a crucial step in the carnitine biosynthetic pathway, contributing to the synthesis of L-carnitine, an essential molecule involved in the transport of fatty acids into the mitochondria for β-oxidation. BBOX1's function in this pathway is instrumental for maintaining cellular energy homeostasis, as L-carnitine serves as a cofactor in fatty acid metabolism, facilitating their efficient utilization as a source of energy. The catalytic activity of BBOX1 underscores its significance in regulating key metabolic processes and highlights its role as a key player in cellular energy metabolism.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Others

Source

E. coli

Tag

N-6*His

Accession

Q47CX0 (M35-D282)

Gene ID

/

Molecular Construction
N-term
6*His
Cld (M35-D282)
Accession # Q47CX0
C-term
Synonyms
rDeChlorite dismutase/Cld, His; Chlorite dismutase; Chlorite O(2)-lyase; Daro_2580; Cld
AA Sequence

MQPMQSMKIERGTILTQPGVFGVFTMFKLRPDWNKVPVAERKGAAEEVKKLIEKHKDNVLVDLYLTRGLETNSDFFFRINAYDLAKAQTFMREFRSTTVGKNADVFETLVGVTKPLNYISKDKSPGLNAGLSSATYSGPAPRYVIVIPVKKNAEWWNMSPEERLKEMEVHTTPTLAYLVNVKRKLYHSTGLDDTDFITYFETDDLTAFNNLMLSLAQVKENKFHVRWGSPTTLGTIHSPEDVIKALAD

Molecular Weight

Approximately 32.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 0.5 mM EDTA, 4% sucrose, 0.02% Tween 80, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Chlorite Dismutase/Cld Protein, Dechloromonas aromatica (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Chlorite Dismutase/Cld Protein, Dechloromonas aromatica (His)
Cat. No.:
HY-P70068
Quantity:
MCE Japan Authorized Agent: