1. Recombinant Proteins
  2. Receptor Proteins
  3. CHRNA1 Protein, Mouse (His-SUMO)

The CHRNA1 protein, also known as the acetylcholine receptor (AChR), undergoes significant conformational changes upon binding of acetylcholine. This change affects all subunits, causing the opening of ion-conducting channels across the plasma membrane. CHRNA1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived CHRNA1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of CHRNA1 Protein, Mouse (His-SUMO) is 210 a.a., with molecular weight of ~40.5 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CHRNA1 protein, also known as the acetylcholine receptor (AChR), undergoes significant conformational changes upon binding of acetylcholine. This change affects all subunits, causing the opening of ion-conducting channels across the plasma membrane. CHRNA1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived CHRNA1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of CHRNA1 Protein, Mouse (His-SUMO) is 210 a.a., with molecular weight of ~40.5 kDa.

Background

The CHRNA1 protein, also known as the alpha-1 subunit of the acetylcholine receptor (AChR), plays a crucial role in mediating cellular responses upon acetylcholine binding. As a component of the AChR, it is part of a pentameric structure consisting of two alpha chains, a beta, a delta, and either a gamma (in immature muscle) or epsilon (in mature muscle) chain. Upon acetylcholine binding, the AChR undergoes an extensive conformational change across all subunits, resulting in the opening of an ion-conducting channel across the plasma membrane. This process is integral to the transmission of nerve signals at the neuromuscular junction. Additionally, the muscle heteropentamer, comprising alpha-1, beta-1, delta, and epsilon subunits, interacts with the alpha-conotoxin ImII, further highlighting the intricate molecular interactions involved in the functionality of CHRNA1 within the acetylcholine receptor complex.

Species

Mouse

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

P04756 (S21-L230)

Gene ID
Molecular Construction
N-term
6*His-SUMO
CHRNA1 (S21-L230)
Accession # P04756
C-term
Synonyms
Chrna1; Acra; Acetylcholine receptor subunit alpha
AA Sequence

SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL

Molecular Weight

Approximately 40.5 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CHRNA1 Protein, Mouse (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CHRNA1 Protein, Mouse (His-SUMO)
Cat. No.:
HY-P72142
Quantity:
MCE Japan Authorized Agent: