CHRNA1 Protein, Mouse (His-SUMO)

The CHRNA1 protein, also known as the acetylcholine receptor (AChR), undergoes significant conformational changes upon binding of acetylcholine. This change affects all subunits, causing the opening of ion-conducting channels across the plasma membrane. CHRNA1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived CHRNA1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of CHRNA1 Protein, Mouse (His-SUMO) is 210 a.a., with molecular weight of ~40.5 kDa.

The CHRNA1 protein, also known as the alpha-1 subunit of the acetylcholine receptor (AChR), plays a crucial role in mediating cellular responses upon acetylcholine binding. As a component of the AChR, it is part of a pentameric structure consisting of two alpha chains, a beta, a delta, and either a gamma (in immature muscle) or epsilon (in mature muscle) chain. Upon acetylcholine binding, the AChR undergoes an extensive conformational change across all subunits, resulting in the opening of an ion-conducting channel across the plasma membrane. This process is integral to the transmission of nerve signals at the neuromuscular junction. Additionally, the muscle heteropentamer, comprising alpha-1, beta-1, delta, and epsilon subunits, interacts with the alpha-conotoxin ImII, further highlighting the intricate molecular interactions involved in the functionality of CHRNA1 within the acetylcholine receptor complex.

Mouse

E. coli

N-6*His;N-SUMO

P04756 (S21-L230)

11435  [NCBI]

SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL

Approximately 40.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.