CHRNA3 Protein, Human (His-SUMO)

CHRNA3 Protein, a critical contributor to collagen fibrillogenesis, regulates the rate of fibril formation and influences the assembly and organization of collagen fibrils. Binding to both type I and type II collagen, CHRNA3 plays a pivotal role in shaping the structural integrity of the extracellular matrix. CHRNA3 Protein, Human (His-SUMO) is the recombinant human-derived CHRNA3 protein, expressed by E. coli , with N-10*His, N-SUMO labeled tag. The total length of CHRNA3 Protein, Human (His-SUMO) is 209 a.a., with molecular weight of ~44.6 kDa.

Fibromodulin, a protein with a pivotal role in collagen fibrillogenesis, significantly influences the rate of fibril formation and may serve as a primary contributor to this process. Known to bind both type I and type II collagen, Fibromodulin plays a crucial role in modulating the assembly and organization of collagen fibrils. Its impact on the dynamics of fibrillogenesis suggests its involvement in shaping the structural integrity of the extracellular matrix.

Human

E. coli

N-10*His;N-SUMO

P32297 (S32-L240)

1136  [NCBI]

SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL

Approximately 44.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.