1. Recombinant Proteins
  2. Receptor Proteins
  3. Claudin-3/CLDN3 Protein, Human (His-B2M)

Claudin-3/CLDN3 Protein, Human (His-B2M)

Cat. No.: HY-P72146
COA Handling Instructions

Claudin-3/CLDN3 proteins play a critical role in tight junctions, eliminating intercellular spaces through calcium-independent cell adhesion activity. It exhibits multifunctionality by forming homo- and heteropolymers with other CLDN members, including CLDN1 and CLDN2. Claudin-3/CLDN3 Protein, Human (His-B2M) is the recombinant human-derived Claudin-3/CLDN3 protein, expressed by E. coli , with N-6*His, B2M labeled tag. The total length of Claudin-3/CLDN3 Protein, Human (His-B2M) is 51 a.a., with molecular weight of ~19.7 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg $220 In-stock
50 μg $420 In-stock
100 μg $672 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Claudin-3/CLDN3 proteins play a critical role in tight junctions, eliminating intercellular spaces through calcium-independent cell adhesion activity. It exhibits multifunctionality by forming homo- and heteropolymers with other CLDN members, including CLDN1 and CLDN2. Claudin-3/CLDN3 Protein, Human (His-B2M) is the recombinant human-derived Claudin-3/CLDN3 protein, expressed by E. coli , with N-6*His, B2M labeled tag. The total length of Claudin-3/CLDN3 Protein, Human (His-B2M) is 51 a.a., with molecular weight of ~19.7 kDa.

Background

Claudin-3/CLDN3 Protein assumes a crucial role in the specific obliteration of the intercellular space within tight junctions, employing calcium-independent cell-adhesion activity. This protein demonstrates its versatility by forming both homo- and heteropolymers with other CLDN members, including interactions with CLDN1 and CLDN2 homopolymers. Additionally, Claudin-3/CLDN3 directly engages with tight junction-associated proteins TJP1/ZO-1, TJP2/ZO-2, and TJP3/ZO-3, emphasizing its integral role in the assembly and maintenance of tight junction complexes. The ability to form polymers and interact with key junctional components highlights Claudin-3/CLDN3's significance in regulating cell adhesion and the structural integrity of intercellular spaces.

Species

Human

Source

E. coli

Tag

N-6*His;N-B2M

Accession

O15551 (R30-R80)

Gene ID
Molecular Construction
N-term
6*His-B2M
CLDN3 (R30-R80)
Accession # O15551
C-term
Synonyms
C7orf1; Claudin-3; Claudin3; CLD3_HUMAN; CLDN 3; Cldn3; Clostridium perfringens enterotoxin receptor 2; CPE R2; CPE receptor 2; CPE-R 2; CPE-receptor 2; CPETR 2; CPETR2; HRVP 1; HRVP1; Rat ventral prostate 1 like protein; Rat ventral prostate.1 protein homolog; RVP1; Ventral prostate.1 like protein; Ventral prostate.1 protein homolog
AA Sequence

RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR

Molecular Weight

Approximately 21 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Claudin-3/CLDN3 Protein, Human (His-B2M) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Claudin-3/CLDN3 Protein, Human (His-B2M)
Cat. No.:
HY-P72146
Quantity:
MCE Japan Authorized Agent: