1. Recombinant Proteins
  2. Receptor Proteins
  3. Pattern Recognition Receptors
  4. C-type Lectin Receptors
  5. CLEC-1
  6. CLEC-1/CLEC1A Protein, Human (HEK293, Fc)

CLEC-1/CLEC1A proteins belong to the CTL/CTLD superfamily and are known for their diverse functions in cell adhesion, signaling, glycoprotein turnover, inflammation, and immune responses. It is involved in potentially regulating dendritic cell function. CLEC-1/CLEC1A Protein, Human (HEK293, Fc) is the recombinant human-derived CLEC-1/CLEC1A protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CLEC-1/CLEC1A proteins belong to the CTL/CTLD superfamily and are known for their diverse functions in cell adhesion, signaling, glycoprotein turnover, inflammation, and immune responses. It is involved in potentially regulating dendritic cell function. CLEC-1/CLEC1A Protein, Human (HEK293, Fc) is the recombinant human-derived CLEC-1/CLEC1A protein, expressed by HEK293 , with N-hFc labeled tag.

Background

The C-type lectin-like domain-containing protein 1 (CLEC1A) is a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily, known for its diverse functions, including cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. This protein is implicated in the potential regulation of dendritic cell function. Situated on chromosome 12p13 in the natural killer gene complex region, CLEC1A is closely linked to other members of the CTL/CTLD superfamily. Alternative splicing gives rise to multiple transcript variants, contributing to the functional diversity of this gene. With biased expression observed in placenta (RPKM 18.1), lung (RPKM 3.8), and 10 other tissues, CLEC1A underscores its potential role in various physiological contexts.

Species

Human

Source

HEK293

Tag

N-hFc

Accession

Q8NC01/NP_057595.2 (Q77-D280)

Gene ID
Molecular Construction
N-term
hFc
CLEC-1 (Q77-D280)
Accession # Q8NC01/NP_057595.2
C-term
Synonyms
CLEC1A; C-type lectin domain family 1 member A; CLEC1
AA Sequence

QLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEKLCRELYNKAGAHRCSPCTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAILNGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD

Molecular Weight

Approximately 56.48 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 (Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization) or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CLEC-1/CLEC1A Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CLEC-1/CLEC1A Protein, Human (HEK293, Fc)
Cat. No.:
HY-P75338
Quantity:
MCE Japan Authorized Agent: