1. Recombinant Proteins
  2. Receptor Proteins
  3. Pattern Recognition Receptors
  4. C-type Lectin Receptors
  5. CLEC-2
  6. CLEC1B/CLEC-2 Protein, Mouse (HEK293, Fc)

The CLEC1B/CLEC-2 protein serves as a platelet receptor for PDPN. When activated, it signals through SRC and SYK kinases, activating PLCG2. CLEC1B forms homodimers and interacts with RACK1, promoting its ubiquitination and degradation. It also interacts with SYK and PDPN, independently of glycosylation, activating CLEC1B/CLEC-2. CLEC1B/CLEC-2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CLEC1B/CLEC-2 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of CLEC1B/CLEC-2 Protein, Mouse (HEK293, Fc) is 177 a.a., with molecular weight of 50-65 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

CLEC1B/CLEC-2 Protein, Mouse (HEK293, Fc) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CLEC1B/CLEC-2 protein serves as a platelet receptor for PDPN. When activated, it signals through SRC and SYK kinases, activating PLCG2. CLEC1B forms homodimers and interacts with RACK1, promoting its ubiquitination and degradation. It also interacts with SYK and PDPN, independently of glycosylation, activating CLEC1B/CLEC-2. CLEC1B/CLEC-2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CLEC1B/CLEC-2 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of CLEC1B/CLEC-2 Protein, Mouse (HEK293, Fc) is 177 a.a., with molecular weight of 50-65 kDa.

Background

CLEC1B/CLEC-2 Protein is a C-type lectin-like receptor that serves as a platelet receptor for PDPN, a marker of lymphatic endothelial cells. Upon ligand activation, CLEC1B/CLEC-2 signals through the sequential activation of SRC and SYK tyrosine kinases, ultimately leading to the activation of PLCG2. It forms homodimers and interacts with RACK1 through its cytoplasmic domain, promoting CLEC1B ubiquitination and subsequent degradation via the proteasome pathway. Additionally, CLEC1B/CLEC-2 interacts with SYK in a dimeric form, facilitated by the SH2 domains of SYK. Furthermore, it interacts with PDPN, and this interaction is independent of CLEC1B glycosylation, resulting in the activation of CLEC1B/CLEC-2.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Mouse Podoplanin is coated at 1.0 µg/mL (100 μL/well), Recombinant Mouse CLEC-2 binds with ED50 of 0.2387 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Mouse Podoplanin is coated at 1.0 µg/mL (100 μL/well), Recombinant Mouse CLEC-2 binds with ED50 of 0.2387 μg/mL.
Species

Mouse

Source

HEK293

Tag

N-hFc

Accession

Q9JL99-1 (M53-L229)

Gene ID
Molecular Construction
N-term
hFc
CLEC1B (M53-L229)
Accession # Q9JL99
C-term
Synonyms
C-type lectin domain family 1 member B; CLEC1B; CLEC2
AA Sequence

MSVTQQKYLLAEKENLSATLQQLAKKFCQELIRQSEIKTKSTFEHKCSPCATKWRYHGDSCYGFFRRNLTWEESKQYCTEQNATLVKTASQSTLDYIAERITSVRWIGLSRQNSKKDWMWEDSSVLRKNGINLSGNTEENMNCAYLHNGKIHPASCKERHYLICERNAGMTRVDQLL

Molecular Weight

Approximately 50-65 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CLEC1B/CLEC-2 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CLEC1B/CLEC-2 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P75335
Quantity:
MCE Japan Authorized Agent: