CLEC5A/MDL-1 Protein, Rhesus Macaque (HEK293, His)

CLEC5A Protein is a cell surface receptor that signals via TYROBP, and functions as a positive regulator of osteoclastogenesis. CLEC5A Protein regulates inflammatory responses. CLEC5A/MDL-1 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CLEC5A/MDL-1 protein, expressed by HEK293 , with N-His labeled tag. The total length of CLEC5A/MDL-1 Protein, Rhesus Macaque (HEK293, His) is 161 a.a., with molecular weight of 25-45 KDa..

CLEC5A Protein is a critical macrophage receptor for dengue virus serotypes 1-4. The binding of CLEC5A Protein to dengue virus triggers signaling through the phosphorylation of TYROBP, and not results in viral entry, but stimulates pro-inflammatory cytokine release^[1][2][3].

Measured by its binding ability in a functional ELISA. When Recombinant Human Galectin-9 Protein is immobilized at 1 µg/mL (100 µL/well) can bind Recombinant Rhesus Macaque CLEC5A. The ED₅₀ for this effect is 15.33 ng/mL.

Rhesus Macaque

HEK293

N-6*His

XP_001085243 (P28-K188)

695425  [NCBI]

PQIFNKSNDGFTTTRSYGTDSQIFGSSSPSPNGFIPTRSYGTVCPEDWEFYQERCFLLPTSESSWNESRDFCKRKGSTLAIVNTPEKLKFLQDIADTEKYFIGLIYNREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDIRYRRICEKNAK

Approximately 25-45 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.