CLIC2/XAP121 Protein, Human (His)

CLIC2/XAP121 protein exhibits the capability to insert into membranes and form chloride ion channels, and the activity of these channels is pH-dependent. The process of membrane insertion appears to be redox-regulated and is likely to occur specifically under oxidizing conditions. Moreover, CLIC2/XAP121 plays a regulatory role in modulating the activity of RYR2 and inhibiting calcium influx. Structurally, it functions as a monomer and is known to interact with TRAPPC2 and RYR2. CLIC2/XAP121 Protein, Human (His) is the recombinant human-derived CLIC2/XAP121 protein, expressed by E. coli , with N-6*His labeled tag. The total length of CLIC2/XAP121 Protein, Human (His) is 247 a.a., with molecular weight of ~32.0 kDa.

CLIC2/XAP121 protein exhibits the capability to insert into membranes and form chloride ion channels, and the activity of these channels is pH-dependent. The process of membrane insertion appears to be redox-regulated and is likely to occur specifically under oxidizing conditions. Moreover, CLIC2/XAP121 plays a regulatory role in modulating the activity of RYR2 and inhibiting calcium influx. Structurally, it functions as a monomer and is known to interact with TRAPPC2 and RYR2.

Human

E. coli

N-6*His

O15247 (M1-S247)

1193  [NCBI]

MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS

Approximately 32.0 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.